PANP/PILR alpha associated neural protein Antibody

Images

 
Western Blot: PANP/PILR alpha associated neural protein Antibody [NBP2-83354] - WB Suggested Anti-C12orf53 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human Spleen

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PANP/PILR alpha associated neural protein Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PANP/PILR alpha associated neural protein. Peptide sequence: VWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PIANP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PANP/PILR alpha associated neural protein Antibody

  • C12orf53
  • chromosome 12 open reading frame 53
  • PANP
  • PIANP
  • PILR alpha associated neural protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3968
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DDX0230P-100
Species: Hu
Applications: Flow, IP, WB
NBP1-89388
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2690
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, WB
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-57362
Species: Hu
Applications: ICC/IF, WB
DAN00
Species: Hu
Applications: ELISA
H00000826-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, PLA, S-ELISA, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-26116
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-83354
Species: Hu
Applications: WB

Publications for PANP/PILR alpha associated neural protein Antibody (NBP2-83354) (0)

There are no publications for PANP/PILR alpha associated neural protein Antibody (NBP2-83354).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PANP/PILR alpha associated neural protein Antibody (NBP2-83354) (0)

There are no reviews for PANP/PILR alpha associated neural protein Antibody (NBP2-83354). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PANP/PILR alpha associated neural protein Antibody (NBP2-83354) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PANP/PILR alpha associated neural protein Products

Bioinformatics Tool for PANP/PILR alpha associated neural protein Antibody (NBP2-83354)

Discover related pathways, diseases and genes to PANP/PILR alpha associated neural protein Antibody (NBP2-83354). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PANP/PILR alpha associated neural protein

There are no specific blogs for PANP/PILR alpha associated neural protein, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PANP/PILR alpha associated neural protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIANP