PANK2 Antibody

Images

 
Western Blot: PANK2 Antibody [NBP1-88295] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: PANK2 Antibody [NBP1-88295] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PANK2 Antibody [NBP1-88295] - Staining of human testis shows cytoplasmic positivity in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PANK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYIDSVGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PANK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PANK2 Protein (NBP1-88295PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PANK2 Antibody

  • C20orf48
  • EC 2.7.1.33
  • FLJ17232
  • Hallervorden-Spatz syndrome
  • HARPFLJ11729
  • hPanK2
  • HSS
  • MGC15053
  • NBIA1
  • pantothenate kinase 2
  • pantothenate kinase 2, mitochondrial
  • Pantothenic acid kinase 2
  • PKANneurodegeneration with brain iron accumulation 1 (Hallervorden-Spatz syndrome)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56762
Species: Hu
Applications: WB, ICC/IF
AF-252-PB
Species: Hu
Applications: WB
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20414
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-82474
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-12553
Species: Hu

Publications for PANK2 Antibody (NBP1-88295) (0)

There are no publications for PANK2 Antibody (NBP1-88295).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PANK2 Antibody (NBP1-88295) (0)

There are no reviews for PANK2 Antibody (NBP1-88295). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PANK2 Antibody (NBP1-88295) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PANK2 Products

Bioinformatics Tool for PANK2 Antibody (NBP1-88295)

Discover related pathways, diseases and genes to PANK2 Antibody (NBP1-88295). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PANK2 Antibody (NBP1-88295)

Discover more about diseases related to PANK2 Antibody (NBP1-88295).
 

Pathways for PANK2 Antibody (NBP1-88295)

View related products by pathway.

PTMs for PANK2 Antibody (NBP1-88295)

Learn more about PTMs related to PANK2 Antibody (NBP1-88295).

Blogs on PANK2

There are no specific blogs for PANK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PANK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PANK2