Palladin Antibody - Azide and BSA Free

Western Blot: Palladin Antibody [NBP2-93983] - Western blot analysis of extracts of various cell lines, using Palladin antibody (NBP2-93983) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunocytochemistry/Immunofluorescence: Palladin Antibody [NBP2-93983] - Analysis of NIH-3T3 cells using Palladin . Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: Palladin Antibody [NBP2-93983] - Paraffin-embedded rat ovary using Palladin .

Immunocytochemistry/Immunofluorescence: Palladin Antibody [NBP2-93983] - Analysis of HeLa cells using Palladin . Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: Palladin Antibody [NBP2-93983] - Paraffin-embedded human colon carcinoma using Palladin .

Immunoprecipitation: Palladin Antibody [NBP2-93983] - Immunoprecipitation analysis of 200ug extracts of A-549 cells using 3ug Palladin antibody (NBP2-93983). Western blot was performed from the immunoprecipitate using Palladin antibody (NBP2-93983) at a dilution of 1:1000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Palladin Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Palladin Antibody - Azide and BSA Free (NBP2-93983) is a polyclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 383-672 of human PALLD (NP_001159582.1). AVNQRGRSPRSPSGHPHVRRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PALLD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 151 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Palladin Antibody - Azide and BSA Free

• CGI151
• CGI-151
• FLJ22190
• FLJ38193
• KIAA0992FLJ39139
• MYN
• myoneurin
• Palladin
• palladin, cytoskeletal associated protein
• PALLD
• PNCA1
• Sarcoma antigen NY-SAR-77
• SIH002
• SIH002FLJ61376

Background

Palladin is a cytoskeletal protein required for organization of normal actin cytoskeleton. Palladin plays roles in establishing cell morphology, motility, cell adhesion and cell-extracellular matrix interactions in a variety of cell types. Palladin may function as a scaffolding molecule with the potential to impact both actin polymerization and the assembly of existing actin filaments into higher-order arrays. It binds to proteins that bind to either monomeric or filamentous actin. It localizes at sites where active actin remodeling takes place, such as lamellipodia and membrane ruffles. Palladin's different isoforms may have functional differences. Palladin is also involved in the control of morphological and cytoskeletal changes associated with dendritic cell maturation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PALLD