PAIP2 Antibody

Images

 
Immunohistochemistry-Paraffin: PAIP2 Antibody [NBP1-80954] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAIP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNA
Specificity
Specificity of human PAIP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAIP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PAIP2 Protein (NBP1-80954PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PAIP2 Antibody

  • MGC72018
  • PABC1-interacting protein 2
  • PABP-interacting protein 2
  • PAIP-2
  • PAIP2APoly(A)-binding protein-interacting protein 2
  • poly(A) binding protein interacting protein 2
  • polyA-binding protein-interacting protein 2
  • polyadenylate-binding protein-interacting protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
H00010605-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-30969
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24632
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
AF6548
Species: Hu, Mu
Applications: IHC
NBP1-80954
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PAIP2 Antibody (NBP1-80954) (0)

There are no publications for PAIP2 Antibody (NBP1-80954).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAIP2 Antibody (NBP1-80954) (0)

There are no reviews for PAIP2 Antibody (NBP1-80954). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PAIP2 Antibody (NBP1-80954) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PAIP2 Antibody (NBP1-80954)

Discover related pathways, diseases and genes to PAIP2 Antibody (NBP1-80954). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAIP2 Antibody (NBP1-80954)

Discover more about diseases related to PAIP2 Antibody (NBP1-80954).
 

Pathways for PAIP2 Antibody (NBP1-80954)

View related products by pathway.

PTMs for PAIP2 Antibody (NBP1-80954)

Learn more about PTMs related to PAIP2 Antibody (NBP1-80954).

Blogs on PAIP2

There are no specific blogs for PAIP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAIP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAIP2