PAF1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PAF1 Antibody [NBP2-54958] - Staining of human cell line MCF7 shows localization to nucleoplasm & cell junctions.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAF1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ADEKLLEEEIQAPTSSKRSQQHAKVVPWMRKTEYISTEFNRYGISNEKPEVKIGVSVKQQFTEEEIYKDRDSQITAIEKTFEDAQKSISQHYSKPRVTP
Specificity
Specificity of human PAF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
PAF1 Knockout 293T Cell Lysate
Control Peptide
PAF1 Recombinant Protein Antigen (NBP2-54958PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PAF1 Antibody

  • F23149_1
  • FLJ11123
  • Paf1, RNA polymerase II associated factor, homolog (S. cerevisiae)
  • Pancreatic differentiation protein 2
  • PD2hPAF1
  • RNA polymerase II-associated factor 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-184
Species: Hu, Mu
Applications: WB, IP
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-61052
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-67753
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-68205
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB600-276
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00009825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF1086
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-2242
Species: Hu, Mu
Applications: WB, ChIP, IP
NB100-558
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP1-83508
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP, KD
H00006919-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-93707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006920-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-60411
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ, KD
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC

Publications for PAF1 Antibody (NBP2-54958) (0)

There are no publications for PAF1 Antibody (NBP2-54958).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAF1 Antibody (NBP2-54958) (0)

There are no reviews for PAF1 Antibody (NBP2-54958). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PAF1 Antibody (NBP2-54958) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PAF1 Products

Array NBP2-54958

Bioinformatics Tool for PAF1 Antibody (NBP2-54958)

Discover related pathways, diseases and genes to PAF1 Antibody (NBP2-54958). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAF1 Antibody (NBP2-54958)

Discover more about diseases related to PAF1 Antibody (NBP2-54958).
 

Pathways for PAF1 Antibody (NBP2-54958)

View related products by pathway.

PTMs for PAF1 Antibody (NBP2-54958)

Learn more about PTMs related to PAF1 Antibody (NBP2-54958).
 

Research Areas for PAF1 Antibody (NBP2-54958)

Find related products by research area.

Blogs on PAF1

There are no specific blogs for PAF1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAF1