PACSIN3 Antibody - BSA Free

Western Blot: PACSIN3 Antibody [NBP3-38573] - Western blot analysis of various lysates using PACSIN3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PACSIN3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PACSIN3 Antibody - BSA Free (NBP3-38573) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 175-424 of human PACSIN3 (NP_057307.2).
  
  Sequence:
  KADSAVSQEQLRKLQERVERCAKEAEKTKAQYEQTLAELHRYTPRYMEDMEQAFETCQAAERQRLLFFKDMLLTLHQHLDLSSSEKFHELHRDLHQGIEAASDEEDLRWWRSTHGPGMAMNWPQFEEWSLDTQRTISRKEKGGRSPDEVTLTSIVPTRDGTAPPPQSPGSPGTGQDEEWSDEESPRKAATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVECVGA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PACSIN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 48 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PACSIN3 Antibody - BSA Free

• Endophilin I
• FLJ17861
• protein kinase C and casein kinase substrate in neurons 3
• protein kinase C and casein kinase substrate in neurons protein 3
• SDPIII
• SH3 domain-containing protein 6511
• syndapin III

Background

PACSIN3 (protein kinase C and casein kinase substrate in neurons protein 3) is a member of the PACSIN family, a group of adaptor protein that regulate vesicle trafficking via cytoskeletal alterations. PACSIN3 is primarily expressed in skeletal muscle and heart and has been shown to be specifically involved in the trafficking of GLUT 1 in adipocytes. PACSIN3 is also known as SH3 domain-containing 6511, syndapin III, and SDPIII.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PACSIN3