PACSIN2 Antibody

Images

 
Western Blot: PACSIN2 Antibody [NBP2-13723] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: PACSIN2 Antibody [NBP2-13723] - Staining of human cell line CACO-2 shows localization to nuclear speckles, plasma membrane, cytosol & vesicles.
Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human kidney shows moderate cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PACSIN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYP TDWS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PACSIN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PACSIN2 Protein (NBP2-13723PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PACSIN2 Antibody

  • cytoplasmic phosphoprotein PACSIN2
  • protein kinase C and casein kinase substrate in neurons 2
  • protein kinase C and casein kinase substrate in neurons protein 2
  • SDPII
  • syndapin II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33756
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-80220
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-03475
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-33283
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56035
Species: Hu
Applications: WB, ICC/IF
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
126-FL/CF
Species: Hu
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF7869
Species: Hu
Applications: WB, ICC
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02356
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PACSIN2 Antibody (NBP2-13723) (0)

There are no publications for PACSIN2 Antibody (NBP2-13723).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PACSIN2 Antibody (NBP2-13723) (0)

There are no reviews for PACSIN2 Antibody (NBP2-13723). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PACSIN2 Antibody (NBP2-13723) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PACSIN2 Products

Bioinformatics Tool for PACSIN2 Antibody (NBP2-13723)

Discover related pathways, diseases and genes to PACSIN2 Antibody (NBP2-13723). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PACSIN2 Antibody (NBP2-13723)

Discover more about diseases related to PACSIN2 Antibody (NBP2-13723).
 

Pathways for PACSIN2 Antibody (NBP2-13723)

View related products by pathway.

PTMs for PACSIN2 Antibody (NBP2-13723)

Learn more about PTMs related to PACSIN2 Antibody (NBP2-13723).

Blogs on PACSIN2

There are no specific blogs for PACSIN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PACSIN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PACSIN2