PACSIN2 Antibody


Western Blot: PACSIN2 Antibody [NBP2-13723] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more
Immunocytochemistry/ Immunofluorescence: PACSIN2 Antibody [NBP2-13723] - Staining of human cell line CACO-2 shows localization to nuclear speckles, plasma membrane, cytosol & vesicles.
Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining in human adrenal gland and skeletal muscle tissues using anti-PACSIN2 antibody. Corresponding PACSIN2 RNA-seq data are presented for the same more
Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human kidney shows moderate cytoplasmic positivity in renal tubules.
Immunohistochemistry: PACSIN2 Antibody [NBP2-13723] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PACSIN2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYP TDWS
Specificity of human PACSIN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
PACSIN2 Lysate (NBP2-65125)
Control Peptide
PACSIN2 Protein (NBP2-13723PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PACSIN2 Antibody

  • cytoplasmic phosphoprotein PACSIN2
  • protein kinase C and casein kinase substrate in neurons 2
  • protein kinase C and casein kinase substrate in neurons protein 2
  • syndapin II


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC
Species: Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PACSIN2 Antibody (NBP2-13723) (0)

There are no publications for PACSIN2 Antibody (NBP2-13723).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PACSIN2 Antibody (NBP2-13723) (0)

There are no reviews for PACSIN2 Antibody (NBP2-13723). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PACSIN2 Antibody (NBP2-13723) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PACSIN2 Antibody (NBP2-13723)

Discover related pathways, diseases and genes to PACSIN2 Antibody (NBP2-13723). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PACSIN2 Antibody (NBP2-13723)

Discover more about diseases related to PACSIN2 Antibody (NBP2-13723).

Pathways for PACSIN2 Antibody (NBP2-13723)

View related products by pathway.

PTMs for PACSIN2 Antibody (NBP2-13723)

Learn more about PTMs related to PACSIN2 Antibody (NBP2-13723).

Blogs on PACSIN2

There are no specific blogs for PACSIN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PACSIN2 Antibody and receive a gift card or discount.


Gene Symbol PACSIN2