PACSIN3 Antibody

Images

 
Western Blot: PACSIN3 Antibody [NBP2-48707] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PACSIN3 Antibody [NBP2-48707] - Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PACSIN3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EWSLDTQRTISRKEKGGRSPDEVTLTSIVPTRDGTAPPPQSPGSPGTGQDEEWSDEESP
Specificity
Specificity of human PACSIN3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PACSIN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
PACSIN3 Lysate (NBP2-66074)
Control Peptide
PACSIN3 Recombinant Protein Antigen (NBP2-48707PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PACSIN3 Antibody

  • Endophilin I
  • FLJ17861
  • protein kinase C and casein kinase substrate in neurons 3
  • protein kinase C and casein kinase substrate in neurons protein 3
  • SDPIII
  • SH3 domain-containing protein 6511
  • syndapin III

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24481
Species: Hu, Pm, Xp
Applications: WB, IHC-P
NBP2-33756
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-82512
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-75395
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
259-HE/CF
Species: Hu
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NB110-74960
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02609
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87561
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA

Publications for PACSIN3 Antibody (NBP2-48707) (0)

There are no publications for PACSIN3 Antibody (NBP2-48707).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PACSIN3 Antibody (NBP2-48707) (0)

There are no reviews for PACSIN3 Antibody (NBP2-48707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PACSIN3 Antibody (NBP2-48707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PACSIN3 Antibody (NBP2-48707)

Discover related pathways, diseases and genes to PACSIN3 Antibody (NBP2-48707). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PACSIN3 Antibody (NBP2-48707)

Discover more about diseases related to PACSIN3 Antibody (NBP2-48707).
 

Pathways for PACSIN3 Antibody (NBP2-48707)

View related products by pathway.

PTMs for PACSIN3 Antibody (NBP2-48707)

Learn more about PTMs related to PACSIN3 Antibody (NBP2-48707).
 

Research Areas for PACSIN3 Antibody (NBP2-48707)

Find related products by research area.

Blogs on PACSIN3

There are no specific blogs for PACSIN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PACSIN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PACSIN3