DORFIN Antibody

Images

 
Western Blot: DORFIN Antibody [NBP1-87989] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: DORFIN Antibody [NBP1-87989] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DORFIN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF19A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DORFIN Protein (NBP1-87989PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DORFIN Antibody

  • DKFZp566B1346
  • dorfin
  • Double ring-finger protein
  • E3 ubiquitin-protein ligase RNF19A
  • EC 6.3.2
  • EC 6.3.2.-
  • p38
  • protein p38 interacting with transcription factor Sp1
  • RING finger protein 19 isoform
  • ring finger protein 19
  • ring finger protein 19Ap38 protein
  • ring-IBR-ring domain containing protein Dorfin
  • RNF19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2265
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-04351
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87989
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for DORFIN Antibody (NBP1-87989) (0)

There are no publications for DORFIN Antibody (NBP1-87989).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DORFIN Antibody (NBP1-87989) (0)

There are no reviews for DORFIN Antibody (NBP1-87989). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DORFIN Antibody (NBP1-87989) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DORFIN Products

Bioinformatics Tool for DORFIN Antibody (NBP1-87989)

Discover related pathways, diseases and genes to DORFIN Antibody (NBP1-87989). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DORFIN Antibody (NBP1-87989)

Discover more about diseases related to DORFIN Antibody (NBP1-87989).
 

Pathways for DORFIN Antibody (NBP1-87989)

View related products by pathway.

PTMs for DORFIN Antibody (NBP1-87989)

Learn more about PTMs related to DORFIN Antibody (NBP1-87989).
 

Research Areas for DORFIN Antibody (NBP1-87989)

Find related products by research area.

Blogs on DORFIN

There are no specific blogs for DORFIN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DORFIN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF19A