DORFIN Antibody


Western Blot: DORFIN Antibody [NBP1-87989] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: DORFIN Antibody [NBP1-87989] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

DORFIN Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCL
Specificity of human DORFIN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DORFIN Protein (NBP1-87989PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DORFIN Antibody

  • DKFZp566B1346
  • dorfin
  • Double ring-finger protein
  • E3 ubiquitin-protein ligase RNF19A
  • EC 6.3.2
  • EC 6.3.2.-
  • p38
  • protein p38 interacting with transcription factor Sp1
  • RING finger protein 19 isoform
  • ring finger protein 19
  • ring finger protein 19Ap38 protein
  • ring-IBR-ring domain containing protein Dorfin
  • RNF19


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for DORFIN Antibody (NBP1-87989) (0)

There are no publications for DORFIN Antibody (NBP1-87989).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DORFIN Antibody (NBP1-87989) (0)

There are no reviews for DORFIN Antibody (NBP1-87989). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DORFIN Antibody (NBP1-87989) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DORFIN Products

Bioinformatics Tool for DORFIN Antibody (NBP1-87989)

Discover related pathways, diseases and genes to DORFIN Antibody (NBP1-87989). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DORFIN Antibody (NBP1-87989)

Discover more about diseases related to DORFIN Antibody (NBP1-87989).

Pathways for DORFIN Antibody (NBP1-87989)

View related products by pathway.

PTMs for DORFIN Antibody (NBP1-87989)

Learn more about PTMs related to DORFIN Antibody (NBP1-87989).

Research Areas for DORFIN Antibody (NBP1-87989)

Find related products by research area.

Blogs on DORFIN

There are no specific blogs for DORFIN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DORFIN Antibody and receive a gift card or discount.


Gene Symbol RNF19A