PAAF1 Antibody

Images

 
Western Blot: PAAF1 Antibody [NBP1-82310] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PAAF1 Antibody [NBP1-82310] - Staining of human stomach shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAAF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GNIYQLDVRSPRAPVQVIHRSGAPVLSLLSVRDGFIASQGDGSCFIVQQDLDYVTELTGADCDPVYKVATWEKQIYTCCRDGLVRRYQLSDL
Specificity
Specificity of human PAAF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAAF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PAAF1 Protein (NBP1-82310PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PAAF1 Antibody

  • FLJ11848
  • PAAF
  • proteasomal ATPase-associated factor 1
  • Protein G-16
  • Rpn14
  • WD repeat domain 71
  • WD repeat-containing protein 71
  • WDR71

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80961
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP1-87800
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-82310
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PAAF1 Antibody (NBP1-82310) (0)

There are no publications for PAAF1 Antibody (NBP1-82310).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAAF1 Antibody (NBP1-82310) (0)

There are no reviews for PAAF1 Antibody (NBP1-82310). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAAF1 Antibody (NBP1-82310) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PAAF1 Antibody (NBP1-82310)

Discover related pathways, diseases and genes to PAAF1 Antibody (NBP1-82310). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAAF1 Antibody (NBP1-82310)

Discover more about diseases related to PAAF1 Antibody (NBP1-82310).
 

Pathways for PAAF1 Antibody (NBP1-82310)

View related products by pathway.

Blogs on PAAF1

There are no specific blogs for PAAF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAAF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAAF1