PA28 Activator beta Subunit/PSME2 Antibody

Images

 
Western Blot: PA28 Activator beta Subunit/PSME2 Antibody [NBP2-57628] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: PA28 Activator beta Subunit/PSME2 Antibody [NBP2-57628] - Staining of human cell line U-2 OS shows localization to nucleus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PA28 Activator beta Subunit/PSME2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK
Specificity
Specificity of human PA28 Activator beta Subunit/PSME2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSME2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
PA28 Activator beta Subunit/PSME2 Knockout 293T Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PA28 Activator beta Subunit/PSME2 Antibody

  • 11S regulator complex beta subunit
  • 11S regulator complex subunit beta
  • Activator of multicatalytic protease subunit 2
  • MCP Activator
  • MCP activator, 31-kD subunit
  • PA28 Activator beta Subunit
  • PA28b
  • PA28betacell migration-inducing protein 22
  • proteasome (prosome, macropain) activator subunit 2 (PA28 beta)
  • Proteasome activator 28 subunit beta
  • proteasome activator 28-beta
  • proteasome activator complex subunit 2
  • proteasome activator hPA28 subunit beta
  • PSME2
  • REGbeta
  • REG-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75606
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33498
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-75554
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88660
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NB120-6405
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
AF2818
Species: Hu
Applications: WB, ICC
NBP2-61871
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-922
Species: Ch
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59071
Species: Hu, Po, Bv, Sh
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57628
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628) (0)

There are no publications for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628) (0)

There are no reviews for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PA28 Activator beta Subunit/PSME2 Products

Bioinformatics Tool for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628)

Discover related pathways, diseases and genes to PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628)

Discover more about diseases related to PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628).
 

Pathways for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628)

View related products by pathway.

PTMs for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628)

Learn more about PTMs related to PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628).
 

Research Areas for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628)

Find related products by research area.

Blogs on PA28 Activator beta Subunit/PSME2

There are no specific blogs for PA28 Activator beta Subunit/PSME2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PA28 Activator beta Subunit/PSME2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSME2