We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PA28 Activator beta Subunit/PSME2 Antibody - BSA Free

Images

 
Western Blot: PA28 Activator beta Subunit/PSME2 Antibody [NBP2-57628] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: PA28 Activator beta Subunit/PSME2 Antibody [NBP2-57628] - Staining of human cell line U-2 OS shows localization to nucleus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

PA28 Activator beta Subunit/PSME2 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK
Predicted Species
Mouse (93%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSME2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PA28 Activator beta Subunit/PSME2 Recombinant Protein Antigen (NBP2-57628PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PA28 Activator beta Subunit/PSME2 Antibody - BSA Free

  • 11S regulator complex beta subunit
  • 11S regulator complex subunit beta
  • Activator of multicatalytic protease subunit 2
  • MCP Activator
  • MCP activator, 31-kD subunit
  • PA28 Activator beta Subunit
  • PA28b
  • PA28betacell migration-inducing protein 22
  • proteasome (prosome, macropain) activator subunit 2 (PA28 beta)
  • Proteasome activator 28 subunit beta
  • proteasome activator 28-beta
  • proteasome activator complex subunit 2
  • proteasome activator hPA28 subunit beta
  • PSME2
  • REGbeta
  • REG-beta

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the beta subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three beta and three alpha subunits combine to form a heterohexameric ring. Six pseudogenes have been identified on chromosomes 4, 5, 8, 10 and 13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83121
Species: Hu
Applications:  IHC-P, Simple Western, WB
NBP1-33498
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
485-MI
Species: Mu
Applications: BA
NBP2-71261
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, WB
H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-88660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-82145
Species: Hu
Applications: ELISA
H00006890-M04
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
AF2818
Species: Hu
Applications: ICC, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-31769
Species: Hu
Applications: IHC,  IHC-P
NBP2-93797
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB600-922
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
NBP1-86968
Species: Hu
Applications: IHC,  IHC-P
NBP2-57628
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628) (0)

There are no publications for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628) (0)

There are no reviews for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PA28 Activator beta Subunit/PSME2 Products

Research Areas for PA28 Activator beta Subunit/PSME2 Antibody (NBP2-57628)

Find related products by research area.

Blogs on PA28 Activator beta Subunit/PSME2

There are no specific blogs for PA28 Activator beta Subunit/PSME2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PA28 Activator beta Subunit/PSME2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PSME2