PA28 Activator alpha Subunit/PSME1 Antibody - Azide and BSA Free

Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B01P] - Analysis of PSME1 expression in A-431.

Immunocytochemistry/Immunofluorescence: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B01P] - Analysis of purified antibody to PSME1 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody [H00005720-B01P] - Analysis of PSME1 expression in transfected 293T cell line by PSME1 polyclonal antibody. Lane 1: PSME1 transfected lysate(27.5 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PA28 Activator alpha Subunit/PSME1 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PSME1 (AAH00352, 1 a.a. - 249 a.a.) full-length human protein. MAMLRVQPEAQAKVDVFREDLCTKAENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
• Specificity: PSME1 - proteasome (prosome, macropain) activator subunit 1 (PA28 alpha),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PSME1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PA28 Activator alpha Subunit/PSME1 Antibody - Azide and BSA Free

• 11S regulator complex alpha subunit
• 11S Regulator Complex Subunit alpha
• 29-kD MCP activator subunit
• IFI5111
• IFI5111MGC8628
• IGUP I-5111
• Interferon gamma up-regulated I-5111 protein
• interferon-gamma IEF SSP 5111
• interferon-gamma-inducible protein 5111
• PA28 Activator alpha Subunit
• PA28a
• PA28alphaActivator of multicatalytic protease subunit 1
• proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
• Proteasome activator 28 subunit alpha
• proteasome activator complex subunit 1
• proteasome activator subunit-1
• PSME1
• REG alpha
• REGalpha
• REG-alpha

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the alpha subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three alpha and three beta subunits combine to form a heterohexameric ring. Two transcripts encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSME1
• Entrez:
  • 5720(Human)
• Uniprot:
  • AAH00352(Human)