PA28 Activator alpha Subunit/PSME1 Antibody (6H7X3)

Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody (6H7X3) [NBP3-16543] - Western blot analysis of extracts of various cell lines, using PA28 Activator alpha Subunit/PSME1 Rabbit mAb (NBP3-16543) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 6H7X3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PA28 Activator alpha Subunit/PSME1 Antibody (6H7X3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human PA28 Activator alpha Subunit/PSME1 (NP_006254.1). MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQ
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PSME1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PA28 Activator alpha Subunit/PSME1 Antibody (6H7X3)

• 11S regulator complex alpha subunit
• 11S Regulator Complex Subunit alpha
• 29-kD MCP activator subunit
• IFI5111
• IFI5111MGC8628
• IGUP I-5111
• Interferon gamma up-regulated I-5111 protein
• interferon-gamma IEF SSP 5111
• interferon-gamma-inducible protein 5111
• PA28 Activator alpha Subunit
• PA28A
• PA28alphaActivator of multicatalytic protease subunit 1
• proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
• Proteasome activator 28 subunit alpha
• proteasome activator complex subunit 1
• proteasome activator subunit-1
• PSME1
• REG alpha
• REGalpha
• REG-alpha

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the alpha subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three alpha and three beta subunits combine to form a heterohexameric ring. Two transcripts encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSME1