p70 S6 Kinase beta/S6K2 Antibody

Images

 
Western Blot: p70 S6 Kinase beta/S6K2 Antibody [NBP1-87805] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: p70 S6 Kinase beta/S6K2 Antibody [NBP1-87805] - Staining of human esophagus shows nuclear and cytoplasmic positivity in squamous epithelial cells.
Western Blot: p70 S6 Kinase beta/S6K2 Antibody [NBP1-87805] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-412

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p70 S6 Kinase beta/S6K2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS6KB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p70 S6 Kinase beta/S6K2 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • KLS
  • p70 ribosomal S6 kinase beta
  • p70 S6 Kinase beta
  • p70 S6KB
  • p70 S6K-beta
  • p70(S6K)-beta
  • p70-beta
  • P70-beta-1
  • P70-beta-2
  • p70-S6K 2
  • P70S6K2
  • p70S6Kb
  • ribosomal protein S6 kinase beta-2
  • ribosomal protein S6 kinase, 70kD, polypeptide 2,70 kDa ribosomal protein S6 kinase 2
  • ribosomal protein S6 kinase, 70kDa, polypeptide 2
  • RPS6KB2
  • S6K2
  • S6K-beta
  • S6K-beta2
  • S6K-beta-2
  • serine/threonine-protein kinase 14 beta
  • Serine/threonine-protein kinase 14B
  • SRK
  • STK14B
  • STK14BS6 kinase-related kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-20362
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87805
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for p70 S6 Kinase beta/S6K2 Antibody (NBP1-87805) (0)

There are no publications for p70 S6 Kinase beta/S6K2 Antibody (NBP1-87805).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p70 S6 Kinase beta/S6K2 Antibody (NBP1-87805) (0)

There are no reviews for p70 S6 Kinase beta/S6K2 Antibody (NBP1-87805). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p70 S6 Kinase beta/S6K2 Antibody (NBP1-87805) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p70 S6 Kinase beta/S6K2 Products

Bioinformatics Tool for p70 S6 Kinase beta/S6K2 Antibody (NBP1-87805)

Discover related pathways, diseases and genes to p70 S6 Kinase beta/S6K2 Antibody (NBP1-87805). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p70 S6 Kinase beta/S6K2 Antibody (NBP1-87805)

Discover more about diseases related to p70 S6 Kinase beta/S6K2 Antibody (NBP1-87805).
 

Pathways for p70 S6 Kinase beta/S6K2 Antibody (NBP1-87805)

View related products by pathway.

PTMs for p70 S6 Kinase beta/S6K2 Antibody (NBP1-87805)

Learn more about PTMs related to p70 S6 Kinase beta/S6K2 Antibody (NBP1-87805).

Blogs on p70 S6 Kinase beta/S6K2

There are no specific blogs for p70 S6 Kinase beta/S6K2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p70 S6 Kinase beta/S6K2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KB2
Entrez