p53 AIP1 Recombinant Protein Antigen

Images

 
There are currently no images for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

p53 AIP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human p53 AIP1.

Source: E. coli

Amino Acid Sequence: GIEALSVSSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TP53AIP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48917.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for p53 AIP1 Recombinant Protein Antigen

  • p53AIP1
  • p53-regulated apoptosis-inducing protein 1
  • tumor protein p53 regulated apoptosis inducing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67358
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-24737
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
NB600-1159
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-76638
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IF
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NB100-2736
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-68008
Species: Hu
NB100-556
Species: Hu
Applications: WB, IP
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO

Publications for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP) (0)

There are no publications for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP) (0)

There are no reviews for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional p53 AIP1 Products

Bioinformatics Tool for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP)

Discover related pathways, diseases and genes to p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP)

Discover more about diseases related to p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP).

Research Areas for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP)

Find related products by research area.

Blogs on p53 AIP1

There are no specific blogs for p53 AIP1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p53 AIP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TP53AIP1
Novus 100% Guarantee