p53 AIP1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human p53 AIP1. Source: E. coli
Amino Acid Sequence: GIEALSVSSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TP53AIP1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48917. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for p53 AIP1 Recombinant Protein Antigen
Background
The novel protein p53 AIP1, p53-regulated apoptosis inducing protein 1, has been identified from the direct cloning of p53 binding sequences from human genomic DNA. The expression of p53 AIP1 in mitochondria is induced by wild-type p53, which leads to apoptotic cell death through dissipation of mitochondrial Dym. Severe DNA damage causes the phosphorylation of p53 at Ser-46,p53 AIP1 expression, and apoptotic cell death. DNA damage-inducible apoptotic cell death was enhanced through transcriptional activation of p53 AIP1. P53R2 is directly regulated by p53 for supplying nucleotides to repair damaged DNA, thus plays a pivotal role in cell survival by repairing damaged DNA in the nucleus and that dysfunction of this pathway might result in activation of p53 dependent apoptosis to eliminate dangerous cells. In the opposite, p53 AIP1 is likely to play an important role in mediating p53-dependent apoptosis, and phosphorylation of Ser 46 regulates the transcriptional activation of this apoptosis inducing gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ICC, IHC
Publications for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP) (0)
There are no publications for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP) (0)
There are no reviews for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP) (0)
Additional p53 AIP1 Products
Research Areas for p53 AIP1 Recombinant Protein Antigen (NBP2-48917PEP)
Find related products by research area.
|
Blogs on p53 AIP1