p53 AIP1 Antibody [Alexa Fluor® 594]

Images

 

Product Details

Summary
Product Discontinued
View other related p53 AIP1 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-38400AF594
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

p53 AIP1 Antibody [Alexa Fluor® 594] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human p53 AIP1 (NP_001238893.1).

Sequence:
MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TP53AIP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for p53 AIP1 Antibody [Alexa Fluor® 594]

  • p53AIP1
  • p53-regulated apoptosis-inducing protein 1
  • tumor protein p53 regulated apoptosis inducing protein 1

Background

The novel protein p53 AIP1, p53-regulated apoptosis inducing protein 1, has been identified from the direct cloning of p53 binding sequences from human genomic DNA. The expression of p53 AIP1 in mitochondria is induced by wild-type p53, which leads to apoptotic cell death through dissipation of mitochondrial Dym. Severe DNA damage causes the phosphorylation of p53 at Ser-46,p53 AIP1 expression, and apoptotic cell death. DNA damage-inducible apoptotic cell death was enhanced through transcriptional activation of p53 AIP1. P53R2 is directly regulated by p53 for supplying nucleotides to repair damaged DNA, thus plays a pivotal role in cell survival by repairing damaged DNA in the nucleus and that dysfunction of this pathway might result in activation of p53 dependent apoptosis to eliminate dangerous cells. In the opposite, p53 AIP1 is likely to play an important role in mediating p53-dependent apoptosis, and phosphorylation of Ser 46 regulates the transcriptional activation of this apoptosis inducing gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24737
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-84161
Species: Hu
Applications: IHC,  IHC-P
NB600-1159
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-76638
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NBP1-76639
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF6897
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB100-2736
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DPG00
Species: Hu
Applications: ELISA
NBP3-04850
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-556
Species: Hu
Applications: IP, WB

Publications for p53 AIP1 Antibody (NBP3-38400AF594) (0)

There are no publications for p53 AIP1 Antibody (NBP3-38400AF594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p53 AIP1 Antibody (NBP3-38400AF594) (0)

There are no reviews for p53 AIP1 Antibody (NBP3-38400AF594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p53 AIP1 Antibody (NBP3-38400AF594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p53 AIP1 Products

Array NBP3-38400AF594

Research Areas for p53 AIP1 Antibody (NBP3-38400AF594)

Find related products by research area.

Blogs on p53 AIP1

There are no specific blogs for p53 AIP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p53 AIP1 Antibody [Alexa Fluor® 594] and receive a gift card or discount.

Bioinformatics

Gene Symbol TP53AIP1