We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

P2Y12/P2RY12 Recombinant Protein Antigen

Images

 
There are currently no images for P2Y12/P2RY12 Protein (NBP2-33870PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

P2Y12/P2RY12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P2RY12.

Source: E. coli

Amino Acid Sequence: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
P2RY12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33870.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for P2Y12/P2RY12 Recombinant Protein Antigen

  • ADPG-R
  • Gi-coupled ADP receptor HORK3
  • HORK3
  • HORK3P2Y12 platelet ADP receptor
  • P2RY12
  • P2T(AC)
  • P2Y purinoceptor 12
  • P2Y(AC)
  • P2Y(ADP)
  • P2Y(cyc)
  • P2Y12
  • P2Y12ADP-glucose receptor
  • purinergic receptor P2RY12
  • purinergic receptor P2Y, G-protein coupled, 12
  • putative G-protein coupled receptor
  • SP1999
  • SP1999G-protein coupled receptor SP1999

Background

P2Y12 is a Purinergic Receptor essential for the aggregation of blood platelets. There is evidence that mutations in P2Y12 cause a bleeding disorder, suggesting that knowledge of the P2Y12 receptor could advance the development of antiplatelet agents to treat cardiovascular diseases. Expression of P2Y12 has been reported in platelets, spinal cord, and many brain regions. ESTs for P2Y12 have been isolated from B-cell/lung/testis, brain, embryo, prostate, eye, kidney carcinoma, and colon carcinoma libraries. Cognate

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61664
Species: Hu, Rt
Applications: ELISA, Flow, IHC,  IHC-P, WB
NBP2-00555
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB1266
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
137-PS
Species: Hu
Applications: BA
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP3-10546
Species: Hu
Applications: WB
NBP3-48734
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
211-TBB/CF
Species: Hu
Applications: BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-13721
Species: Hu
Applications: IHC,  IHC-P
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-92089
Species: Hu
Applications: IHC,  IHC-P, WB
DCDL40
Species: Hu
Applications: ELISA
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-90260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for P2Y12/P2RY12 Protein (NBP2-33870PEP) (0)

There are no publications for P2Y12/P2RY12 Protein (NBP2-33870PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2Y12/P2RY12 Protein (NBP2-33870PEP) (0)

There are no reviews for P2Y12/P2RY12 Protein (NBP2-33870PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for P2Y12/P2RY12 Protein (NBP2-33870PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional P2Y12/P2RY12 Products

Research Areas for P2Y12/P2RY12 Protein (NBP2-33870PEP)

Find related products by research area.

Blogs on P2Y12/P2RY12

There are no specific blogs for P2Y12/P2RY12, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our P2Y12/P2RY12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RY12