p23/PTGES3 Antibody

Images

 
Western Blot: p23/PTGES3 Antibody [NBP1-85485] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: p23/PTGES3 Antibody [NBP1-85485] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: p23/PTGES3 Antibody [NBP1-85485] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferous ducts.
Immunocytochemistry/ Immunofluorescence: p23/PTGES3 Antibody [NBP1-85485] - Staining of human cell line U-2 OS shows positivity in cytoplasm.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p23/PTGES3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGES3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
p23/PTGES3 Protein (NBP1-85485PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p23/PTGES3 Antibody

  • CPGES
  • cPGESp23
  • Cytosolic prostaglandin E2 synthase
  • Hsp90 co-chaperone
  • p23
  • P23cytosolic prostaglandin E synthase
  • Progesterone receptor complex p23
  • prostaglandin E synthase 3 (cytosolic)
  • prostaglandin E synthase 3
  • PTGES3
  • TEBP
  • TEBPEC 5.3.99.3
  • Telomerase-binding protein p23
  • unactive progesterone receptor, 23 kD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87852
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF4210
Species: Hu
Applications: WB, IHC
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB120-2813
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IP
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-45904
Species: Hu
Applications: WB, IHC, IF
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
NBP1-97503
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Md, Pm, Rb, Sh, Xp
Applications: WB, IHC, IHC-P, IP
NBP1-85485
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for p23/PTGES3 Antibody (NBP1-85485) (0)

There are no publications for p23/PTGES3 Antibody (NBP1-85485).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p23/PTGES3 Antibody (NBP1-85485) (0)

There are no reviews for p23/PTGES3 Antibody (NBP1-85485). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p23/PTGES3 Antibody (NBP1-85485) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p23/PTGES3 Products

Bioinformatics Tool for p23/PTGES3 Antibody (NBP1-85485)

Discover related pathways, diseases and genes to p23/PTGES3 Antibody (NBP1-85485). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p23/PTGES3 Antibody (NBP1-85485)

Discover more about diseases related to p23/PTGES3 Antibody (NBP1-85485).
 

Pathways for p23/PTGES3 Antibody (NBP1-85485)

View related products by pathway.

PTMs for p23/PTGES3 Antibody (NBP1-85485)

Learn more about PTMs related to p23/PTGES3 Antibody (NBP1-85485).
 

Research Areas for p23/PTGES3 Antibody (NBP1-85485)

Find related products by research area.

Blogs on p23/PTGES3

There are no specific blogs for p23/PTGES3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p23/PTGES3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGES3
Entrez