p23/PTGES3 Antibody - BSA Free

Western Blot: p23/PTGES3 Antibody [NBP1-85485] - Analysis using Anti-PTGES3 antibody NBP1-85485 (A) shows similar pattern to independent antibody NBP1-85486 (B).

Western Blot: p23/PTGES3 Antibody [NBP1-85485] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat wistar bladder tumour cells).

Immunocytochemistry/Immunofluorescence: p23/PTGES3 Antibody [NBP1-85485] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Staining of human duodenum shows moderate nuclear and cytoplasmic positivity in glandular cells.

Staining of human fallopian tube shows strong nuclear and cytoplasmic positivity in glandular cells.

Staining of human fallopian tube, gastrointestinal, skeletal muscle and testis HPA038673 (A) shows similar protein distribution across tissues to independent antibody HPA038672 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

p23/PTGES3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTGES3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  p23/PTGES3 Protein (NBP1-85485PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for p23/PTGES3 Antibody - BSA Free

• CPGES
• cPGESp23
• Cytosolic prostaglandin E2 synthase
• Hsp90 co-chaperone
• p23
• P23cytosolic prostaglandin E synthase
• Progesterone receptor complex p23
• prostaglandin E synthase 3 (cytosolic)
• prostaglandin E synthase 3
• PTGES3
• TEBP
• TEBPEC 5.3.99.3
• Telomerase-binding protein p23
• unactive progesterone receptor, 23 kD

Background

Steroid receptors are ligand-dependent intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate hormone. Prior to activation, steroid receptors associate with a number of different proteins in both a stable and transient fashion. Steroid receptor complex proteins include heat shock proteins (HSP 70 and HSP 90), immunosuppressant binding proteins called immunophilins (the FK 506 binding proteins, FKBP 52 & FKBP 54 and the cyclosporin binding protein, CyP-40) and at least three other proteins termed p23, p60 and p48. p23 along with HSP 70, HSP 90 and p60, combine with progesterone receptor (PR) as members of a transient intermediate complex. Cloned human p23 encodes a protein of 160 amino acids that is highly conserved between species and shows no homology to previously identified proteins. p23 is a highly acidic phosphoprotein with an aspartic acid-rich C-terminal domain and multiple potential phosphorylation sites. In vitro studies have suggested that p23 binds to HSP90 and is necessary for the binding of HSP 90 and CyP-40 to PR. While neither its exact function nor mechanism of action have been identified, p23 appears to be an important factor in PR function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for p23/PTGES3 Antibody (NBP1-85485)(1)

Publication using NBP1-85485

• Noddings CM, Wang RY, Johnson JL, Agard DA. Structure of Hsp90-p23-GR reveals the Hsp90 client-remodelling mechanism Nature 2022-01-20 [PMID: 34937936] (Western Blot)

Bioinformatics

• Gene Symbol: PTGES3