p23/PTGES3 Antibody (10M9W8)

Western Blot: p23/PTGES3 Antibody (10M9W8) [NBP3-16586] - Western blot analysis of extracts of various cell lines, using p23/PTGES3 Rabbit mAb (NBP3-16586) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunocytochemistry/Immunofluorescence: p23/PTGES3 Antibody (10M9W8) [NBP3-16586] - Immunofluorescence analysis of U-2 OS cells using p23/PTGES3 Rabbit mAb (NBP3-16586) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Western Blot: p23/PTGES3 Antibody (10M9W8) [NBP3-16586] - Western blot analysis of extracts of various cell lines, using p23/PTGES3 Rabbit mAb (NBP3-16586) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunocytochemistry/Immunofluorescence: p23/PTGES3 Antibody (10M9W8) [NBP3-16586] - Immunofluorescence analysis of C6 cells using p23/PTGES3 Rabbit mAb (NBP3-16586) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: p23/PTGES3 Antibody (10M9W8) [NBP3-16586] - Immunofluorescence analysis of NIH-3T3 cells using p23/PTGES3 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 10M9W8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

p23/PTGES3 Antibody (10M9W8) Summary

• Description: Novus Biologicals Rabbit p23/PTGES3 Antibody (10M9W8) (NBP3-16586) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p23/PTGES3 (NP_006592.3). MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PTGES3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:1000 - 1:5000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for p23/PTGES3 Antibody (10M9W8)

• CPGES
• cPGESp23
• Cytosolic prostaglandin E2 synthase
• Hsp90 co-chaperone
• p23
• P23cytosolic prostaglandin E synthase
• Progesterone receptor complex p23
• prostaglandin E synthase 3 (cytosolic)
• prostaglandin E synthase 3
• PTGES3
• TEBP
• TEBPEC 5.3.99.3
• Telomerase-binding protein p23
• unactive progesterone receptor, 23 kD

Background

Steroid receptors are ligand-dependent intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate hormone. Prior to activation, steroid receptors associate with a number of different proteins in both a stable and transient fashion. Steroid receptor complex proteins include heat shock proteins (HSP 70 and HSP 90), immunosuppressant binding proteins called immunophilins (the FK 506 binding proteins, FKBP 52 & FKBP 54 and the cyclosporin binding protein, CyP-40) and at least three other proteins termed p23, p60 and p48. p23 along with HSP 70, HSP 90 and p60, combine with progesterone receptor (PR) as members of a transient intermediate complex. Cloned human p23 encodes a protein of 160 amino acids that is highly conserved between species and shows no homology to previously identified proteins. p23 is a highly acidic phosphoprotein with an aspartic acid-rich C-terminal domain and multiple potential phosphorylation sites. In vitro studies have suggested that p23 binds to HSP90 and is necessary for the binding of HSP 90 and CyP-40 to PR. While neither its exact function nor mechanism of action have been identified, p23 appears to be an important factor in PR function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTGES3