P11 Antibody

Images

 
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human lymph node.
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining in human esophagus and skeletal muscle tissues using anti-ENDOU antibody. Corresponding ENDOU RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human esophagus, lymph node, skeletal muscle and testis using Anti-ENDOU antibody NBP1-82458 (A) shows similar ...read more
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human testis.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

P11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRY
Specificity
Specificity of human P11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ENDOU
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (83%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for P11 Antibody

  • EC 3.1
  • endonuclease, polyU-specific
  • MGC133268
  • P11,26 serine protease
  • Placental protein 11
  • poly(U)-specific endoribonuclease
  • PP1122 serine protease
  • Protein endoU
  • PRSS26
  • Uridylate-specific endoribonuclease

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31310
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD, KO
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45545
Species: Hu
Applications: WB, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00027130-P02
Species: Hu
H00057804-M01A
Species: Hu
Applications: WB, ELISA
H00056655-Q01
Species: Hu
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2065
Species: Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for P11 Antibody (NBP1-82458) (0)

There are no publications for P11 Antibody (NBP1-82458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P11 Antibody (NBP1-82458) (0)

There are no reviews for P11 Antibody (NBP1-82458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for P11 Antibody (NBP1-82458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional P11 Products

Bioinformatics Tool for P11 Antibody (NBP1-82458)

Discover related pathways, diseases and genes to P11 Antibody (NBP1-82458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P11 Antibody (NBP1-82458)

Discover more about diseases related to P11 Antibody (NBP1-82458).
 

Pathways for P11 Antibody (NBP1-82458)

View related products by pathway.

PTMs for P11 Antibody (NBP1-82458)

Learn more about PTMs related to P11 Antibody (NBP1-82458).

Blogs on P11

There are no specific blogs for P11, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our P11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ENDOU
COVID-19 update