P-Cadherin Antibody - BSA Free

Immunohistochemistry-Paraffin: P-Cadherin Antibody [NBP1-85707] - Analysis in human skin and skeletal muscle tissues. Corresponding CDH3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: P-Cadherin Antibody [NBP1-85707] - Staining of human skin shows moderate membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: P-Cadherin Antibody [NBP1-85707] - Staining of human colon shows weak membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: P-Cadherin Antibody [NBP1-85707] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.

Immunohistochemistry-Paraffin: P-Cadherin Antibody [NBP1-85707] - Staining of human placenta shows moderate membranous positivity in trohoblastic cells.

Analysis in human cell line RT-4.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

P-Cadherin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit P-Cadherin Antibody - BSA Free (NBP1-85707) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-P-Cadherin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTDLDAPNSPAWRATYLIMGGDDGDHFTITTHPE
• Marker: Intercellular Junctions Marker
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDH3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  P-Cadherin Protein (NBP1-85707PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for P-Cadherin Antibody - BSA Free

• CAD3
• cadherin 3, P-cadherin (placental)
• cadherin 3, type 1, P-cadherin (placental)
• Cadherin-3
• CDH3
• CDHP
• CDHPcalcium-dependent adhesion protein, placental
• HJMD
• PCAD
• PCadherin
• P-Cadherin
• PCADP-cadherin
• Placental cadherin

Background

The cadherins are a family of Ca++-dependent adhesion molecules that function to mediate cell-cell binding critical to the maintenance of tissue structure and morphogenesis. Cadherins each contain a large extracellular domain at the amino terminus, which is characterized by a series of five homologous repeats, the most distal of which is thought to be responsible for binding specificity. The relatively short carboxy terminal, intracellular domain interacts with a variety of cytoplasmic proteins, including beta-catenin, to regulate cadherin function. R-cadherin (for retinal-cadherin, also designated cadherin-4), which was first identified in the retina of chicken, has been shown to be involved in the development of striated muscle and potentially epithelia in addition to its involvement in retinal development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for P-Cadherin Antibody (NBP1-85707)(3)

Publications using NBP1-85707

• Bassam AM, Eesa AN et al. Expression of E-Cadherin and P-Cadherin in Breast Carcinoma. Middle-East Journal of Scientific Research. 2015-01-01 (IHC-P, Human)
• Yang CC, Yip HK, Chen KH et al. Impact of impaired cardiac function on the progression of chronic kidney disease---role of pharmacomodulation of valsartan.. Am J Transl Res 2017-05-31 [PMID: 28560004] (IF/IHC, ICC/IF, Rat)
• Fawzy A, Allah S, Salem M, Al Farouk L Immunohistochemical and Histopathological Study of Anaplastic Lymphoma Kinase and Tyrosine-kinase Receptor Expression in Bronchogenic Carcinoma Open Access Macedonian Journal of Medical Sciences 2021-02-18 (IHC-P, Human)

Bioinformatics

• Gene Symbol: CDH3