Recombinant Human OX40/TNFRSF4 Protein

Product Discontinued

Recombinant Human OX40/TNFRSF4 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 31-130 of Human OX40/TNFRSF4
  
  

  Source: Wheat Germ

  Amino Acid Sequence: CVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPP

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: TNFRSF4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OX40/TNFRSF4 Protein

• ACT-135
• ACT35 antigen
• ACT35ATC35 antigen
• CD134 antigen
• CD134
• Ly-70
• OX40 cell surface antigen
• OX40 homologue
• OX40
• OX40L receptor
• OX40lymphoid activation antigene ACT35
• TAX transcriptionally-activated glycoprotein 1 receptor
• tax-transcriptionally activated glycoprotein 1 receptor
• TNFRSF4
• tumor necrosis factor receptor superfamily member 4
• tumor necrosis factor receptor superfamily, member 4
• Txgp1
• TXGP1L
• TXGP1LOX40 antigen

Background

TNFRSF4 - tumor necrosis factor receptor superfamily, member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TNFRSF4