OVCA2 Antibody

Images

 
Western Blot: OVCA2 Antibody [NBP2-56767] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: OVCA2 Antibody [NBP2-56767] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OVCA2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAE
Specificity
Specificity of human OVCA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OVCA2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OVCA2 Recombinant Protein Antigen (NBP2-56767PEP)

Reactivity Notes

Mouse 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for OVCA2 Antibody

  • candidate tumor suppressor in ovarian cancer 2
  • ovarian cancer gene-2 protein
  • ovarian cancer-associated gene 2 protein
  • ovarian tumor suppressor candidate 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-56693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-04142
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF756
Species: Mu
Applications: WB, IHC
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003090-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
H00007520-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-404
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP2-02483
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-215
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-03061
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-81758
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01017
Species: Hu
Applications: WB, Flow, IHC, IHC-P
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NBP1-52654
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-56767
Species: Hu
Applications: WB, ICC/IF

Publications for OVCA2 Antibody (NBP2-56767) (0)

There are no publications for OVCA2 Antibody (NBP2-56767).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OVCA2 Antibody (NBP2-56767) (0)

There are no reviews for OVCA2 Antibody (NBP2-56767). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OVCA2 Antibody (NBP2-56767) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OVCA2 Products

Bioinformatics Tool for OVCA2 Antibody (NBP2-56767)

Discover related pathways, diseases and genes to OVCA2 Antibody (NBP2-56767). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OVCA2 Antibody (NBP2-56767)

Discover more about diseases related to OVCA2 Antibody (NBP2-56767).
 

Pathways for OVCA2 Antibody (NBP2-56767)

View related products by pathway.

Blogs on OVCA2

There are no specific blogs for OVCA2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OVCA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OVCA2