OVCA1 Antibody - BSA Free

Western Blot: OVCA1 Antibody [NBP1-56693] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Immunohistochemistry-Paraffin: OVCA1 Antibody [NBP1-56693] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm (perinuclear) but not nuclear in hepatocytes, strong signal, low tissue distribution; Primary Antibody Concentration: 1:100

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

OVCA1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to DPH1(DPH1 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of DPH1. Peptide sequence RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for OVCA1 Antibody - BSA Free

• Diphthamide biosynthesis protein 2 homolog-like 1
• Diphthamide biosynthesis protein 2-like
• diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1
• diptheria toxin resistance protein required for diphthamide biosynthesis-like 1
• diptheria toxin resistance protein required for diphthamide biosynthesis-like 1(S. cerevisiae)
• DPH1 homolog (S. cerevisiae)
• DPH1 homolog
• DPH2L
• DPH2L1diphthamide biosynthesis protein 1
• DPH2-like 1
• DPH-like 1 (S. cerevisiae)
• DPH-like 1
• FLJ33211
• hsDph1
• Ovarian cancer-associated gene 1 protein
• ovarian tumor suppressor candidate 1
• OVCA1candidate tumor suppressor in ovarian cancer 1

Background

Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]). Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-40 AF321876.1 1-40 41-1028 BC003099.1 3-990 1029-1410 BP417755.1 78-459 1411-2188 AK090530.1 1484-2261 2189-2200 AF321876.1 2189-2200

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPH1
• Uniprot:
  • Q9BZG8(Human)