Otx1 Antibody (1F2) Summary
Immunogen |
OTX1 (NP_055377, 10 a.a. ~ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVR |
Specificity |
OTX1 (1F2) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
OTX1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/Immunofluorescence
- Knockdown Validated
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Otx1 Antibody (1F2)
Background
This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: BA
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC, IHC, WB
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, S-ELISA, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Publications for Otx1 Antibody (H00005013-M01) (0)
There are no publications for Otx1 Antibody (H00005013-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Otx1 Antibody (H00005013-M01) (0)
There are no reviews for Otx1 Antibody (H00005013-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Otx1 Antibody (H00005013-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Otx1 Products
Bioinformatics Tool for Otx1 Antibody (H00005013-M01)
Discover related pathways, diseases and genes to Otx1 Antibody (H00005013-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Otx1 Antibody (H00005013-M01)
Discover more about diseases related to Otx1 Antibody (H00005013-M01).
| | Pathways for Otx1 Antibody (H00005013-M01)
View related products by pathway.
|
PTMs for Otx1 Antibody (H00005013-M01)
Learn more about PTMs related to Otx1 Antibody (H00005013-M01).
| | Research Areas for Otx1 Antibody (H00005013-M01)
Find related products by research area.
|
Blogs on Otx1