OTUD4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: OTUD4 Antibody [NBP1-84044] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: OTUD4 Antibody [NBP1-84044] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OTUD4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CGSVSTVDEFPEARGEHVHSLPEASVSSKPDEGRTEQSSQTRKADTALASIPPVAEGKAHPPTQILNRERETVPVELEPKRTIQS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OTUD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OTUD4 Protein (NBP1-84044PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OTUD4 Antibody

  • DKFZp434I0721
  • HIV-1 induced protein HIN-1
  • HIV-1-induced protein HIN-1
  • HSHIN1
  • KIAA1046HIN1DUBA6
  • OTU domain containing 4
  • OTU domain-containing protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2790
Species: Hu
Applications: WB
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-07799
Species: Hu
NBP1-84044
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for OTUD4 Antibody (NBP1-84044) (0)

There are no publications for OTUD4 Antibody (NBP1-84044).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OTUD4 Antibody (NBP1-84044) (0)

There are no reviews for OTUD4 Antibody (NBP1-84044). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for OTUD4 Antibody (NBP1-84044) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OTUD4 Products

Bioinformatics Tool for OTUD4 Antibody (NBP1-84044)

Discover related pathways, diseases and genes to OTUD4 Antibody (NBP1-84044). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OTUD4 Antibody (NBP1-84044)

Discover more about diseases related to OTUD4 Antibody (NBP1-84044).
 

Pathways for OTUD4 Antibody (NBP1-84044)

View related products by pathway.

Blogs on OTUD4

There are no specific blogs for OTUD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OTUD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OTUD4