Otubain-1 Antibody

Images

 
Western Blot: Otubain-1 Antibody [NBP1-83670] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Otubain-1 Antibody [NBP1-83670] - Staining of mouse olfactory bulb shows nuclear immunoreactivity in neurons.
Immunohistochemistry-Paraffin: Otubain-1 Antibody [NBP1-83670] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Western Blot: Otubain-1 Antibody [NBP1-83670] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Western Blot: Otubain-1 Antibody [NBP1-83670] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Western Blot: Otubain-1 Antibody [NBP1-83670] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: Otubain-1 Antibody [NBP1-83670] - Staining of mouse cingulate cortex shows nuclear positivity in neurons.
Immunocytochemistry/ Immunofluorescence: Otubain-1 Antibody [NBP1-83670] - Staining of mouse dorsal raphe nucleus shows immunoreactivity in neurons.
Immunocytochemistry/ Immunofluorescence: Otubain-1 Antibody [NBP1-83670] - Staining of mouse hippocampus shows neuronal positivity.
Immunocytochemistry/ Immunofluorescence: Otubain-1 Antibody [NBP1-83670] - Staining of mouse medulla shows nuclear staining in the lateral paragigantocellular nucleus area.
Immunohistochemistry-Paraffin: Otubain-1 Antibody [NBP1-83670] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells and subset of cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Otubain-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OTUB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Otubain-1 Protein (NBP1-83670PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Otubain-1 Antibody

  • Deubiquitinating enzyme OTUB1
  • EC 3.1.2
  • EC 3.4.19.12
  • FLJ20113
  • FLJ40710
  • hOTU1
  • MGC111158
  • OTB1
  • OTB1MGC4584
  • OTU domain, ubiquitin aldehyde binding 1
  • OTU domain-containing ubiquitin aldehyde-binding protein 1
  • OTU1
  • OTU1OTU-domain Ubal-binding 1
  • OTUB1
  • Otubain1
  • Otubain-1
  • ubiquitin thioesterase OTUB1
  • ubiquitin-specific protease otubain 1
  • Ubiquitin-specific-processing protease OTUB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56357
Species: Hu
Applications: WB, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56397
Species: Hu
Applications: WB
AF7217
Species: Hu, Mu
Applications: WB, ICC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
H00078990-D01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24610
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, ICC/IF, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-83670
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF

Publications for Otubain-1 Antibody (NBP1-83670) (0)

There are no publications for Otubain-1 Antibody (NBP1-83670).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Otubain-1 Antibody (NBP1-83670) (0)

There are no reviews for Otubain-1 Antibody (NBP1-83670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Otubain-1 Antibody (NBP1-83670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Otubain-1 Products

Bioinformatics Tool for Otubain-1 Antibody (NBP1-83670)

Discover related pathways, diseases and genes to Otubain-1 Antibody (NBP1-83670). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Otubain-1 Antibody (NBP1-83670)

Discover more about diseases related to Otubain-1 Antibody (NBP1-83670).
 

Pathways for Otubain-1 Antibody (NBP1-83670)

View related products by pathway.

PTMs for Otubain-1 Antibody (NBP1-83670)

Learn more about PTMs related to Otubain-1 Antibody (NBP1-83670).

Blogs on Otubain-1

There are no specific blogs for Otubain-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Otubain-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OTUB1
Entrez