Otubain-1 Antibody - BSA Free

Staining of human small intestine shows moderate nuclear positivity in glandular cells.

Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.

Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Staining of human tonsil shows moderate nuclear and cytoplasmic positivity in germinal and non-germinal center cells.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in MCF-7 cells) transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-OTUB1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Otubain-1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OTUB1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Otubain-1 Protein (NBP1-83670PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Otubain-1 Antibody - BSA Free

• Deubiquitinating enzyme OTUB1
• EC 3.1.2
• EC 3.4.19.12
• FLJ20113
• FLJ40710
• hOTU1
• MGC111158
• OTB1
• OTB1MGC4584
• OTU domain, ubiquitin aldehyde binding 1
• OTU domain-containing ubiquitin aldehyde-binding protein 1
• OTU1
• OTU1OTU-domain Ubal-binding 1
• OTUB1
• Otubain1
• Otubain-1
• ubiquitin thioesterase OTUB1
• ubiquitin-specific protease otubain 1
• Ubiquitin-specific-processing protease OTUB1

Background

The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitinated substrates. It interacts with another ubiquitin protease and an E3 ubiquitin ligase that inhibits cytokine gene transcription in the immune system. It is proposed to function in specific ubiquitin-dependent pathways, possibly by providing an editing function for polyubiquitin chain growth. Alternative splicing results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OTUB1