OSTM1 Antibody (4H1)

Images

 
Sandwich ELISA: OSTM1 Antibody (4H1) [H00028962-M05] - Detection limit for recombinant GST tagged OSTM1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4H1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

OSTM1 Antibody (4H1) Summary

Immunogen
OSTM1 (NP_054747.2, 183 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SNSTVYFLNLFNHTLTCFEHNLQGNAHSLLQTKNYSEVCKNCREAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVPCSDT
Specificity
This product is specific for Human OSTM1 monoclonal antibody (M05), clone 4H1 [Gene ID: 28962].
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
OSTM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Mouse monoclonal antibody raised against a partial recombinant OSTM1.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OSTM1 Antibody (4H1)

  • GIPN
  • GLGAIP-interacting protein N terminus
  • grey-lethal osteopetrosis
  • HSPC019
  • OPTB5
  • osteopetrosis associated transmembrane protein 1
  • osteopetrosis-associated transmembrane protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002770-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP3-17131
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP1-91791
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
664-LI/CF
Species: Hu
Applications: BA
NBP2-46376
Species: Hu
Applications: IHC, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-38958
Species: Hu
Applications: IHC, IHC-P
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP3-04877
Species: Hu, Mu, Rt
Applications: WB
DY417
Species: Mu
Applications: ELISA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
H00028962-M05
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for OSTM1 Antibody (H00028962-M05) (0)

There are no publications for OSTM1 Antibody (H00028962-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OSTM1 Antibody (H00028962-M05) (0)

There are no reviews for OSTM1 Antibody (H00028962-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OSTM1 Antibody (H00028962-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OSTM1 Products

Bioinformatics Tool for OSTM1 Antibody (H00028962-M05)

Discover related pathways, diseases and genes to OSTM1 Antibody (H00028962-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSTM1 Antibody (H00028962-M05)

Discover more about diseases related to OSTM1 Antibody (H00028962-M05).
 

Pathways for OSTM1 Antibody (H00028962-M05)

View related products by pathway.

PTMs for OSTM1 Antibody (H00028962-M05)

Learn more about PTMs related to OSTM1 Antibody (H00028962-M05).

Blogs on OSTM1

There are no specific blogs for OSTM1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OSTM1 Antibody (4H1) and receive a gift card or discount.

Bioinformatics

Gene Symbol OSTM1
Uniprot