Osteocalcin Antibody (2D4)

Images

 
Western Blot: Osteocalcin Antibody (2D4) [H00000632-M01] - Analysis of BGLAP expression in transfected 293T cell line by BGLAP monoclonal antibody (M01), clone 2D4.Lane 1: BGLAP transfected lysate(11 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: Osteocalcin Antibody (2D4) [H00000632-M01] - Analysis of monoclonal antibody to BGLAP on HeLa cell . Antibody concentration 10 ug/ml.
ELISA: Osteocalcin Antibody (2D4) [H00000632-M01] - Detection limit for recombinant GST tagged BGLAP is approximately 0.3ng/ml as a capture antibody.
Immunohistochemistry: Osteocalcin Antibody (2D4) [H00000632-M01] - Osteogenic differentiation in 3D. Immunostaining for Osteocalcin (OCN) and nuclear 4′,6-diamidino-2-phenylindole (DAPI) in 3D cultures after 5 weeks. ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
2D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Osteocalcin Antibody (2D4) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
BGLAP (NP_954642, 52 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Specificity
BGLAP - bone gamma-carboxyglutamate (gla) protein (osteocalcin)
Isotype
IgG1 Lambda
Clonality
Monoclonal
Host
Mouse
Gene
BGLAP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Immunohistochemistry
  • Western Blot 1:500
Application Notes
Use in IHC reported in scientific literature (PMID:34948393).Antibody reactivity against recombinant protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been use for IF..
Publications
Read Publications using
H00000632-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Osteocalcin Antibody (2D4)

  • BGLAP
  • BGP
  • bone gamma-carboxyglutamate (gla) protein (osteocalcin)
  • bone gamma-carboxyglutamate (gla) protein
  • Bone Gla protein
  • Gamma-carboxyglutamic acid-containing protein
  • OC
  • OCN
  • Osteocalcin

Background

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Osteocalcin Antibody (H00000632-M01)(3)

Reviews for Osteocalcin Antibody (H00000632-M01) (0)

There are no reviews for Osteocalcin Antibody (H00000632-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Osteocalcin Antibody (H00000632-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Osteocalcin Products

Research Areas for Osteocalcin Antibody (H00000632-M01)

Find related products by research area.

Blogs on Osteocalcin

There are no specific blogs for Osteocalcin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Osteocalcin Antibody (2D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol BGLAP
Entrez
OMIM
Uniprot