Osteoactivin/GPNMB Antibody


Western Blot: Osteoactivin/GPNMB Antibody [NBP1-69389] - This Anti-GPNMB antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Osteoactivin/GPNMB Antibody [NBP1-69389] - Staining of human Lung.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Osteoactivin/GPNMB Antibody Summary

Synthetic peptides corresponding to GPNMB(glycoprotein (transmembrane) nmb) The peptide sequence was selected from the N terminal of GPNMB. Peptide sequence DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Osteoactivin/GPNMB Antibody

  • DC-HIL
  • glycoprotein (transmembrane) nmb
  • glycoprotein NMB
  • HGFINglycoprotein nmb-like protein
  • NMBosteoactivin
  • Osteoactivin
  • Transmembrane glycoprotein HGFIN
  • transmembrane glycoprotein NMB


GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential.The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Po, Bt, Bv, Eq, Rb
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Osteoactivin/GPNMB Antibody (NBP1-69389) (0)

There are no publications for Osteoactivin/GPNMB Antibody (NBP1-69389).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Osteoactivin/GPNMB Antibody (NBP1-69389) (0)

There are no reviews for Osteoactivin/GPNMB Antibody (NBP1-69389). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Osteoactivin/GPNMB Antibody (NBP1-69389) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Osteoactivin/GPNMB Products

Bioinformatics Tool for Osteoactivin/GPNMB Antibody (NBP1-69389)

Discover related pathways, diseases and genes to Osteoactivin/GPNMB Antibody (NBP1-69389). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Osteoactivin/GPNMB Antibody (NBP1-69389)

Discover more about diseases related to Osteoactivin/GPNMB Antibody (NBP1-69389).

Pathways for Osteoactivin/GPNMB Antibody (NBP1-69389)

View related products by pathway.

PTMs for Osteoactivin/GPNMB Antibody (NBP1-69389)

Learn more about PTMs related to Osteoactivin/GPNMB Antibody (NBP1-69389).

Research Areas for Osteoactivin/GPNMB Antibody (NBP1-69389)

Find related products by research area.

Blogs on Osteoactivin/GPNMB

There are no specific blogs for Osteoactivin/GPNMB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Osteoactivin/GPNMB Antibody and receive a gift card or discount.


Gene Symbol GPNMB