OSBPL9 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: OSBPL9 Antibody [NBP1-86390] - Staining of human cell line U-2 OS shows localization to cytosol, the Golgi apparatus & vesicles.

Immunohistochemistry-Paraffin: OSBPL9 Antibody [NBP1-86390] - Staining of human kidney shows strong membranous positivity in glomerular cells.

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OSBPL9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSPLEPVISTMPSQTVLPPEPVQLCKSEQRPSSLPVGPVLATLGHHQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTV
• Predicted Species: Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OSBPL9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  OSBPL9 Protein (NBP1-86390PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OSBPL9 Antibody - BSA Free

• FLJ12492
• FLJ14629
• FLJ14801
• FLJ32055
• FLJ34384
• ORP-9
• ORP9MGC15035
• OSBP4
• OSBP-related protein 9
• oxysterol binding protein-like 9
• oxysterol-binding protein-related protein 9

Background

The OSBPL9 gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors.Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-likesterol-binding domain, although so

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OSBPL9