Recombinant Human ORC5L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ORC5L Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 274 - 373 of Human ORC5L partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAILYSIVDSR

Protein/Peptide Type
Partial Recombinant Protein
Gene
ORC5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ORC5L Protein

  • ORC5Lorigin recognition complex, subunit 5-like (yeast)
  • ORC5P
  • ORC5T
  • origin recognition complex subunit 5
  • origin recognition complex, subunit 5 (yeast homolog)-like
  • origin recognition complex, subunit 5 homolog (yeast)
  • origin recognition complex, subunit 5
  • origin recognition complex, subunit 5-like

Background

ORC5L - origin recognition complex, subunit 5-like (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-06099
Species: Hu
NBP1-46175
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-798
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-24600
Species: Hu, Mu
Applications: WB
NBP2-20387
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00023594-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-581
Species: Hu, Rt
Applications: WB, IP
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
DDX0010P-100
Species: Hu, Ca
Applications: Flow, Func, IHC, IHC-Fr, IP
NB100-79778
Species: Hu, Xp
Applications: WB, IHC, PLA
NBP2-14998
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-253
Species: Hu
Applications: WB, IP
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC

Publications for ORC5L Partial Recombinant Protein (H00005001-Q01) (0)

There are no publications for ORC5L Partial Recombinant Protein (H00005001-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORC5L Partial Recombinant Protein (H00005001-Q01) (0)

There are no reviews for ORC5L Partial Recombinant Protein (H00005001-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ORC5L Partial Recombinant Protein (H00005001-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ORC5L Products

Bioinformatics Tool for ORC5L Partial Recombinant Protein (H00005001-Q01)

Discover related pathways, diseases and genes to ORC5L Partial Recombinant Protein (H00005001-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORC5L Partial Recombinant Protein (H00005001-Q01)

Discover more about diseases related to ORC5L Partial Recombinant Protein (H00005001-Q01).
 

Pathways for ORC5L Partial Recombinant Protein (H00005001-Q01)

View related products by pathway.

PTMs for ORC5L Partial Recombinant Protein (H00005001-Q01)

Learn more about PTMs related to ORC5L Partial Recombinant Protein (H00005001-Q01).

Blogs on ORC5L

There are no specific blogs for ORC5L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ORC5L Antibody
NBP1-82476

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ORC5L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ORC5