ORC3L Antibody - BSA Free

Immunohistochemistry-Paraffin: ORC3L Antibody [NBP2-49097] - Staining of human testis shows high expression.

Immunohistochemistry: ORC3L Antibody [NBP2-49097] - Staining of human stomach, lower shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: ORC3L Antibody [NBP2-49097] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: ORC3L Antibody [NBP2-49097] - Staining in human testis and pancreas tissues using anti-ORC3 antibody. Corresponding ORC3 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ORC3L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ORC3L Antibody - BSA Free (NBP2-49097) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ORC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ORC3L Recombinant Protein Antigen (NBP2-49097PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ORC3L Antibody - BSA Free

• IMAGE50150
• LAT
• LATHEOorigin recognition complex, subunit 3-like (yeast)
• ORC3Lhomolog of latheo, Drosophila
• origin recognition complex subunit 3
• Origin recognition complex subunit Latheo
• origin recognition complex, subunit 3 (yeast homolog)-like
• origin recognition complex, subunit 3 honolog (yeast)
• origin recognition complex, subunit 3 honolog
• origin recognition complex, subunit 3
• origin recognition complex, subunit 3-like

Background

ORC3L is involved in DNA replication origin binding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ORC3