Recombinant Human ORC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ORC1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 110 of Human ORC1L partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ORC1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ORC1 Protein

  • HS
  • HSORC1
  • ORC1Lorigin recognition complex subunit 1
  • origin recognition complex, subunit 1 (yeast homolog)-like
  • origin recognition complex, subunit 1 homolog (S. cerevisiae)
  • origin recognition complex, subunit 1 homolog
  • origin recognition complex, subunit 1
  • origin recognition complex, subunit 1-like (yeast)
  • origin recognition complex, subunit 1-like
  • PARC1origin recognition complex 1
  • Replication control protein 1

Background

ORC1L - origin recognition complex, subunit 1-like (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-581
Species: Hu, Rt
Applications: WB, IP
NBP2-06099
Species: Hu
NBP1-46175
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP2-46403
Species: Hu
Applications: IHC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-798
Species: Hu, Mu
Applications: WB, PEP-ELISA
H00023594-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82476
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB100-79778
Species: Hu, Xp
Applications: WB, IHC, PLA
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready

Publications for ORC1 Partial Recombinant Protein (H00004998-Q01) (0)

There are no publications for ORC1 Partial Recombinant Protein (H00004998-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORC1 Partial Recombinant Protein (H00004998-Q01) (0)

There are no reviews for ORC1 Partial Recombinant Protein (H00004998-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ORC1 Partial Recombinant Protein (H00004998-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ORC1 Products

Bioinformatics Tool for ORC1 Partial Recombinant Protein (H00004998-Q01)

Discover related pathways, diseases and genes to ORC1 Partial Recombinant Protein (H00004998-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORC1 Partial Recombinant Protein (H00004998-Q01)

Discover more about diseases related to ORC1 Partial Recombinant Protein (H00004998-Q01).
 

Pathways for ORC1 Partial Recombinant Protein (H00004998-Q01)

View related products by pathway.

PTMs for ORC1 Partial Recombinant Protein (H00004998-Q01)

Learn more about PTMs related to ORC1 Partial Recombinant Protein (H00004998-Q01).
 

Research Areas for ORC1 Partial Recombinant Protein (H00004998-Q01)

Find related products by research area.

Blogs on ORC1

There are no specific blogs for ORC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ORC1 Antibody
NBP2-24600

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ORC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ORC1