Orai1 Antibody

Images

 
Western Blot: Orai1 Antibody [NBP1-85463] - Analysis in control (vector only transfected HEK293T lysate) and ORAI1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: Orai1 Antibody [NBP1-85463] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463] - Analysis in human skin and pancreas tissues using NBP1-85463 antibody. Corresponding Orai1 RNA-seq data are presented for the same tissues.
Western Blot: Orai1 Antibody [NBP1-85463] - Analysis in human cell line NB4.
Immunohistochemistry-Paraffin: Orai1 Antibody [NBP1-85463] - Staining of human skin shows membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Orai1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORAI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Orai1 Protein (NBP1-85463PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Orai1 Antibody

  • CRACM1
  • CRACM1ORAT1
  • FLJ14466
  • ORAI calcium release-activated calcium modulator 1
  • Orai1
  • ORAT1
  • Protein orai-1
  • TMEM142A
  • TMEM142Acalcium release-activated calcium modulator 1
  • Transmembrane protein 142Acalcium release-activated calcium channel protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006786-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-98844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-76956
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-89107
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-05951
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-19630
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-10064
Species: Hu
Applications: WB
NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-77262
Species: Hu, Mu
Applications: ELISA, IF, IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP2-66861
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF6387
Species: Hu
Applications: WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31133
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-20989
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
236-EG
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-33694
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-21399
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NBP1-85463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Orai1 Antibody (NBP1-85463) (0)

There are no publications for Orai1 Antibody (NBP1-85463).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Orai1 Antibody (NBP1-85463) (0)

There are no reviews for Orai1 Antibody (NBP1-85463). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Orai1 Antibody (NBP1-85463) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Orai1 Products

Bioinformatics Tool for Orai1 Antibody (NBP1-85463)

Discover related pathways, diseases and genes to Orai1 Antibody (NBP1-85463). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Orai1 Antibody (NBP1-85463)

Discover more about diseases related to Orai1 Antibody (NBP1-85463).
 

Pathways for Orai1 Antibody (NBP1-85463)

View related products by pathway.

PTMs for Orai1 Antibody (NBP1-85463)

Learn more about PTMs related to Orai1 Antibody (NBP1-85463).
 

Research Areas for Orai1 Antibody (NBP1-85463)

Find related products by research area.

Blogs on Orai1

There are no specific blogs for Orai1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Orai1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ORAI1