OMA1 Antibody - BSA Free

Western Blot: OMA1 Antibody [NBP1-56970] - Lanes: Lane 1 : 10ug human fibroblast mitochondria. Lane 2: 15ug fish embryo lysate ; 6h post fertilization. Lane 3: 30ug fish embryo lysate , 6 days Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-Rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: OMA1.

Western Blot: OMA1 Antibody [NBP1-56970] - Nuclear Lysate, Whole cell lysate, Antibody Titration: 0.2-1 ug/ml.

Western Blot: OMA1 Antibody [NBP1-56970] - Sample Type: HepG2 cells Primary Dilution: 1:1000 Secondary Antibody: anti-Rabbit TBST with 5% BSA Secondary Dilution: 1:5000 Image Submitted by: Hana Sabic University of Utah.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

OMA1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to OMA1 (OMA1 homolog, zinc metallopeptidase (S. cerevisiae)) The peptide sequence was selected from the middle region of OMA1. Peptide sequence WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OMA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for OMA1 Antibody - BSA Free

• 2010001O09Rik
• DAB1
• EC 3.4.24.-
• metalloprotease related protein 1
• Metalloprotease-related protein 1
• MPRP1
• MPRP-1mitochondrial
• OMA1 homolog, zinc metallopeptidase (S. cerevisiae)
• overlapping activity with M-AAA protease
• YKR087C
• ZMPOMA1

Background

OMA1 is a mitochondrial protease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OMA1 Antibody (NBP1-56970)(3)

Publications using NBP1-56970

• Yang Y, Zhang G, Guo F et al. Mitochondrial UQCC3 Modulates Hypoxia Adaptation by Orchestrating OXPHOS and Glycolysis in Hepatocellular Carcinoma Cell Rep 2020-11-03 [PMID: 33147459] (WB, Human)
• Baburamani AA, Hurling C, Stolp H et al. Mitochondrial Optic Atrophy (OPA) 1 Processing Is Altered in Response to Neonatal Hypoxic-Ischemic Brain Injury. Int J Mol Sci 2015-01-01 [PMID: 26393574] (WB)
• Desmurs M, Foti M, Raemy E et al. C11orf83, a Mitochondrial Cardiolipin-Binding Protein Involved in bc1 Complex Assembly and Supercomplex Stabilization. Mol Cell Biol 2015-04-01 [PMID: 25605331]

Bioinformatics

• Gene Symbol: OMA1
• Uniprot:
  • Q96E52(Human)