OC-STAMP Antibody

Images

 
Immunohistochemistry-Paraffin: OC-STAMP Antibody [NBP1-84230] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OC-STAMP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RLQRRHDRHQGQQLPLGDPSCVPTPRPACKPPAWIDYRLDALRTESSEGEGKELWSCRDLSCNLGPVPPPCVTLGKSLHLSEPRFLHLHNDSIFTIDVTYFPRRDVVRMEGNTGHD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OCSTAMP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OC-STAMP Protein (NBP1-84230PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OC-STAMP Antibody

  • C20orf123
  • chromosome 20 open reading frame 123
  • OCSTAMP
  • OC-STAMP
  • transmembrane protein C20orf123

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
MAB7824
Species: Hu
Applications: Flow, CyTOF-ready
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-37292
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-56732
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-33939
Species: Hu
Applications: WB, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NBP1-84230
Species: Hu
Applications: IHC, IHC-P

Publications for OC-STAMP Antibody (NBP1-84230) (0)

There are no publications for OC-STAMP Antibody (NBP1-84230).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OC-STAMP Antibody (NBP1-84230) (0)

There are no reviews for OC-STAMP Antibody (NBP1-84230). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for OC-STAMP Antibody (NBP1-84230) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OC-STAMP Products

OC-STAMP NBP1-84230

Bioinformatics Tool for OC-STAMP Antibody (NBP1-84230)

Discover related pathways, diseases and genes to OC-STAMP Antibody (NBP1-84230). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OC-STAMP

There are no specific blogs for OC-STAMP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OC-STAMP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OCSTAMP
Entrez