Recombinant Human OBFC2A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human OBFC2A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-204 of Human OBFC2A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NABP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OBFC2A Protein

  • DKFZp667M1322
  • FLJ13624
  • FLJ22833
  • hSSB2
  • MGC111163
  • oligonucleotide/oligosaccharide-binding fold containing 2A
  • Oligonucleotide/oligosaccharide-binding fold-containing protein 2A
  • Sensor of single-strand DNA complex subunit B2
  • Sensor of ssDNA subunit B2
  • SOSS complex subunit B2
  • SOSS-B2
  • SSB2Single-stranded DNA-binding protein 2

Background

Single-stranded DNA (ssDNA)-binding proteins, such as OBFC2A, are ubiquitous and essential for a variety of DNA metabolic processes, including replication, recombination, and detection and repair of damage (Richard et al., 2008 [PubMed 18449195]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01578
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBL1-16438
Species: Hu
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-86998
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00023635-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-97475
Species: Hu, Mu, Rt, Ge, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-86170
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for OBFC2A Recombinant Protein (H00064859-P01) (0)

There are no publications for OBFC2A Recombinant Protein (H00064859-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OBFC2A Recombinant Protein (H00064859-P01) (0)

There are no reviews for OBFC2A Recombinant Protein (H00064859-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OBFC2A Recombinant Protein (H00064859-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OBFC2A Products

Bioinformatics Tool for OBFC2A Recombinant Protein (H00064859-P01)

Discover related pathways, diseases and genes to OBFC2A Recombinant Protein (H00064859-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OBFC2A

There are no specific blogs for OBFC2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Mre11 Antibody
NB100-142
OBFC2A Antibody
NBP2-56314

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OBFC2A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NABP1