OBFC2A Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OBFC2A. Source: E. coli Amino Acid Sequence: EPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
NABP1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58805. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for OBFC2A Recombinant Protein Antigen
Background
OBFC2A is also known as hSSB2 or SSB2 and is a homolog of hSSB1 (OBFC2B). OBFC2A, as well as OBFC2B are single-stranded binding proteins that contain an oligonucleotide/oliosaccharide binding fold (OB-fold). OB-fold proteins associate with each other to form multi-OB-fold complexes that associate with DNA-processing complexes that participate in DNA damage repair and replication. OBFC2A has been shown to protect genomic stability, and it is hypothesized that its participation in the DNA damage response may involve RAD51 and the ATM signaling pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ma, Hu, Mu, Pm, Rb, Rt
Applications: ELISA, GS, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: AC
Publications for OBFC2A Recombinant Protein Antigen (NBP2-58805PEP) (0)
There are no publications for OBFC2A Recombinant Protein Antigen (NBP2-58805PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for OBFC2A Recombinant Protein Antigen (NBP2-58805PEP) (0)
There are no reviews for OBFC2A Recombinant Protein Antigen (NBP2-58805PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for OBFC2A Recombinant Protein Antigen (NBP2-58805PEP) (0)
Additional OBFC2A Products
Research Areas for OBFC2A Recombinant Protein Antigen (NBP2-58805PEP)
Find related products by research area.
|
Blogs on OBFC2A