O-GlcNAcase/OGA/MGEA5 Recombinant Protein Antigen

Images

 
There are currently no images for O-GlcNAcase/OGA/MGEA5 Protein (NBP1-81244PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

O-GlcNAcase/OGA/MGEA5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MGEA5.

Source: E.coli

Amino Acid Sequence: WTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVM

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OGA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81244.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for O-GlcNAcase/OGA/MGEA5 Recombinant Protein Antigen

  • bifunctional protein NCOAT
  • FLJ11229
  • GH84
  • HEXC
  • HEXC3
  • Hexosaminidase B
  • hyaluronidase in meningioma
  • KIAA0679
  • MEA5FLJ23355
  • meningioma expressed antigen 5 (hyaluronidase)
  • Meningioma-expressed antigen 5
  • MGEA5
  • NCOAT
  • Nuclear cytoplasmic O-GlcNAcase and acetyltransferase
  • OGA
  • OGlcNAcase
  • O-GlcNAcase

Background

The dynamic modification of cytoplasmic and nuclear proteins by O-linked N-acetylglucosamine (O-GlcNAc) addition and removal on serine and threonine residues is catalyzed by OGT (MIM 300255), which adds O-GlcNAc, and MGEA5, a glycosidase that removes O-GlcNAc modifications (Gao et al., 2001 [PubMed 11148210]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32791
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-95141
Species: Mu, Rt
Applications: IHC-P, WB
NBP2-45435
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF2200
Species: Hu
Applications: IP, WB
NBP1-83289
Species: Hu
Applications: IHC, IHC-P, WB
H00007884-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP3-04382
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14977
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NB400-135
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, IP, KO, PAGE, WB

Publications for O-GlcNAcase/OGA/MGEA5 Protein (NBP1-81244PEP) (0)

There are no publications for O-GlcNAcase/OGA/MGEA5 Protein (NBP1-81244PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for O-GlcNAcase/OGA/MGEA5 Protein (NBP1-81244PEP) (0)

There are no reviews for O-GlcNAcase/OGA/MGEA5 Protein (NBP1-81244PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for O-GlcNAcase/OGA/MGEA5 Protein (NBP1-81244PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional O-GlcNAcase/OGA/MGEA5 Products

Bioinformatics Tool for O-GlcNAcase/OGA/MGEA5 Protein (NBP1-81244PEP)

Discover related pathways, diseases and genes to O-GlcNAcase/OGA/MGEA5 Protein (NBP1-81244PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for O-GlcNAcase/OGA/MGEA5 Protein (NBP1-81244PEP)

Discover more about diseases related to O-GlcNAcase/OGA/MGEA5 Protein (NBP1-81244PEP).
 

Pathways for O-GlcNAcase/OGA/MGEA5 Protein (NBP1-81244PEP)

View related products by pathway.

PTMs for O-GlcNAcase/OGA/MGEA5 Protein (NBP1-81244PEP)

Learn more about PTMs related to O-GlcNAcase/OGA/MGEA5 Protein (NBP1-81244PEP).

Blogs on O-GlcNAcase/OGA/MGEA5

There are no specific blogs for O-GlcNAcase/OGA/MGEA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our O-GlcNAcase/OGA/MGEA5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OGA