We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human NXF1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human NXF1 Protein [H00010482-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related NXF1 Peptides and Proteins

Order Details


    • Catalog Number
      H00010482-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human NXF1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human NXF1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVAMSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NXF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NXF1 GST (N-Term) Protein

  • DKFZp667O0311
  • Mex67
  • mRNA export factor TAP
  • nuclear RNA export factor 1
  • TAPMEX67
  • tip associating protein
  • Tip-associated protein
  • Tip-associating protein

Background

This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. The encoded protein of this gene shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. It is the vertebrate homologue of the yeast protein Mex67p. The encoded protein overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006890-M04
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-93797
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-31769
Species: Hu
Applications: IHC,  IHC-P
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-86968
Species: Hu
Applications: IHC,  IHC-P
NBP3-48848
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
H00029107-M08
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB17582
Species: Mu
Applications: CyTOF-ready, Flow
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
485-MI
Species: Mu
Applications: BA
NBP2-71261
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-84841
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-22412
Species: Hu
Applications: Flow, IHC, WB
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-84796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-64775
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, Func, IHC, IHC-Fr, IHC-P (-), IP

Publications for NXF1 Partial Recombinant Protein (H00010482-Q01) (0)

There are no publications for NXF1 Partial Recombinant Protein (H00010482-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NXF1 Partial Recombinant Protein (H00010482-Q01) (0)

There are no reviews for NXF1 Partial Recombinant Protein (H00010482-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NXF1 Partial Recombinant Protein (H00010482-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NXF1 Products

Blogs on NXF1

There are no specific blogs for NXF1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NXF1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NXF1