Nurr1/NGFI-B beta/NR4A2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Nurr1/NGFI-B beta/NR4A2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NR4A2.
  
  

  Source: E. coli

  Amino Acid Sequence: VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: NR4A2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87765.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nurr1/NGFI-B beta/NR4A2 Recombinant Protein Antigen

• human homolog of
• NGFI-B beta
• NOT
• NR4A2
• nuclear receptor subfamily 4, group A, member 2
• Nurr1
• orphan nuclear receptor NR4A2
• Orphan nuclear receptor NURR1
• T-cell nuclear receptor NOT
• TINUR
• transcriptionally inducible nuclear receptor related 1
• Transcriptionally-inducible nuclear receptor

Background

The Nurr1 gene encodes a member of the steroid-thyroid hormone- retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson's. Nurr1 is a stem cell marker and cooperates with PITX3 to promote terminal maturation of murine and human embryonic stem cell cultures to a midbrain dopamine neuron phenotype. In addition, Nurr1 is involved in the regulation of corticotropin-releasing hormone (CRH), which may be linked to and associated with rheumatoid arthritis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NR4A2