Recombinant Human Nurr1/NGFI-B beta/NR4A2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Nurr1/NGFI-B beta/NR4A2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 71 - 170 of Human NR4A2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFP

Protein/Peptide Type
Partial Recombinant Protein
Gene
NR4A2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nurr1/NGFI-B beta/NR4A2 Protein

  • human homolog of
  • NGFI-B beta
  • NOT
  • NR4A2
  • nuclear receptor subfamily 4, group A, member 2
  • Nurr1
  • orphan nuclear receptor NR4A2
  • Orphan nuclear receptor NURR1
  • T-cell nuclear receptor NOT
  • TINUR
  • transcriptionally inducible nuclear receptor related 1
  • Transcriptionally-inducible nuclear receptor

Background

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Four transcript variants encoding four distinct isoforms have been identified for this gene. Additional alternate splice variants may exist, but their full length nature has not been determined. NR4A2( AAH66890, 71 a.a. - 170 a.a.) partial recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
423-F8/CF
Species: Hu, Mu
NBP1-56518
Species: Hu
Applications: WB
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
MAB3314
Species: Hu, Rt
Applications: IHC
NBP2-41194
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF

Publications for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01) (0)

There are no publications for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01) (0)

There are no reviews for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nurr1/NGFI-B beta/NR4A2 Products

Bioinformatics Tool for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01)

Discover related pathways, diseases and genes to Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01)

Discover more about diseases related to Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01).
 

Pathways for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01)

View related products by pathway.

PTMs for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01)

Learn more about PTMs related to Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01).
 

Research Areas for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01)

Find related products by research area.

Blogs on Nurr1/NGFI-B beta/NR4A2

There are no specific blogs for Nurr1/NGFI-B beta/NR4A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nurr1/NGFI-B beta/NR4A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NR4A2
Entrez