Recombinant Human Nurr1/NGFI-B beta/NR4A2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Nurr1/NGFI-B beta/NR4A2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 71-170 of Human Nurr1/NGFI-B beta/NR4A2

Source: Wheat Germ

Amino Acid Sequence: GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NR4A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nurr1/NGFI-B beta/NR4A2 Protein

  • human homolog of
  • NGFI-B beta
  • NOT
  • NR4A2
  • nuclear receptor subfamily 4, group A, member 2
  • Nurr1
  • orphan nuclear receptor NR4A2
  • Orphan nuclear receptor NURR1
  • T-cell nuclear receptor NOT
  • TINUR
  • transcriptionally inducible nuclear receptor related 1
  • Transcriptionally-inducible nuclear receptor

Background

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Four transcript variants encoding four distinct isoforms have been identified for this gene. Additional alternate splice variants may exist, but their full length nature has not been determined. NR4A2( AAH66890, 71 a.a. - 170 a.a.) partial recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
PP-H7833-00
Species: Hu
Applications: WB, IP
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13891
Species: Hu
Applications: IHC, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
H00063973-M10
Species: Hu, Rt
Applications: WB, ELISA
NBP2-41194
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO

Publications for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01) (0)

There are no publications for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01) (0)

There are no reviews for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nurr1/NGFI-B beta/NR4A2 Products

Bioinformatics Tool for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01)

Discover related pathways, diseases and genes to Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01)

Discover more about diseases related to Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01).
 

Pathways for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01)

View related products by pathway.

PTMs for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01)

Learn more about PTMs related to Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01).
 

Research Areas for Nurr1/NGFI-B beta/NR4A2 Partial Recombinant Protein (H00004929-Q01)

Find related products by research area.

Blogs on Nurr1/NGFI-B beta/NR4A2

There are no specific blogs for Nurr1/NGFI-B beta/NR4A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nurr1/NGFI-B beta/NR4A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NR4A2
Entrez