Nurr1/NGFI-B beta/NR4A2 Antibody

Images

 
Western Blot: Nurr1/NGFI-B beta/NR4A2 Antibody [H00004929-D01P] - Analysis of NR4A2 expression in transfected 293T cell line by NR4A2 polyclonal antibody.Lane 1: NR4A2 transfected lysate(66.60 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: Nurr1/NGFI-B beta/NR4A2 Antibody [H00004929-D01P] - Analysis of antibody to NR4A2 on HeLa cell. Antibody concentration 30 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nurr1/NGFI-B beta/NR4A2 Antibody Summary

Immunogen
NR4A2 (NP_006177.1, 1 a.a. - 598 a.a.) full-length human protein. MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NR4A2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nurr1/NGFI-B beta/NR4A2 Antibody

  • human homolog of
  • NGFI-B beta
  • NOT
  • NR4A2
  • nuclear receptor subfamily 4, group A, member 2
  • Nurr1
  • orphan nuclear receptor NR4A2
  • Orphan nuclear receptor NURR1
  • T-cell nuclear receptor NOT
  • TINUR
  • transcriptionally inducible nuclear receptor related 1
  • Transcriptionally-inducible nuclear receptor

Background

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
423-F8/CF
Species: Hu, Mu
NBP1-56518
Species: Hu
Applications: WB
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
MAB3314
Species: Hu, Rt
Applications: IHC
NBP2-41194
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF

Publications for Nurr1/NGFI-B beta/NR4A2 Antibody (H00004929-D01P) (0)

There are no publications for Nurr1/NGFI-B beta/NR4A2 Antibody (H00004929-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nurr1/NGFI-B beta/NR4A2 Antibody (H00004929-D01P) (0)

There are no reviews for Nurr1/NGFI-B beta/NR4A2 Antibody (H00004929-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nurr1/NGFI-B beta/NR4A2 Antibody (H00004929-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nurr1/NGFI-B beta/NR4A2 Products

Bioinformatics Tool for Nurr1/NGFI-B beta/NR4A2 Antibody (H00004929-D01P)

Discover related pathways, diseases and genes to Nurr1/NGFI-B beta/NR4A2 Antibody (H00004929-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nurr1/NGFI-B beta/NR4A2 Antibody (H00004929-D01P)

Discover more about diseases related to Nurr1/NGFI-B beta/NR4A2 Antibody (H00004929-D01P).
 

Pathways for Nurr1/NGFI-B beta/NR4A2 Antibody (H00004929-D01P)

View related products by pathway.

PTMs for Nurr1/NGFI-B beta/NR4A2 Antibody (H00004929-D01P)

Learn more about PTMs related to Nurr1/NGFI-B beta/NR4A2 Antibody (H00004929-D01P).
 

Research Areas for Nurr1/NGFI-B beta/NR4A2 Antibody (H00004929-D01P)

Find related products by research area.

Blogs on Nurr1/NGFI-B beta/NR4A2

There are no specific blogs for Nurr1/NGFI-B beta/NR4A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nurr1/NGFI-B beta/NR4A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR4A2
Entrez
Uniprot