NUP50 Antibody


Western Blot: NUP50 Antibody [NBP2-13683] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: NUP50 Antibody [NBP2-13683] - Staining of human cell line MCF7 shows localization to nucleoplasm & nuclear membrane.
Immunohistochemistry-Paraffin: NUP50 Antibody [NBP2-13683] - Staining in human testis and heart muscle tissues using anti-NUP50 antibody. Corresponding NUP50 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NUP50 Antibody [NBP2-13683] - Staining of human heart muscle shows low expression as expected.
Immunohistochemistry-Paraffin: NUP50 Antibody [NBP2-13683] - Staining of human testis shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

NUP50 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DSQQPSSSGLASSKACVGNAYHKQLAALDCSVRD
Specificity of human NUP50 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NUP50 Protein (NBP2-13683PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NUP50 Antibody

  • 50 kDa nucleoporin
  • MGC39961
  • NPAP60
  • NPAP60LNucleoporin Nup50
  • nuclear pore complex protein Nup50
  • Nuclear pore-associated protein 60 kDa-like
  • nuclear pore-associated protein 60L
  • nucleoporin 50kD
  • nucleoporin 50kDa


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP, KO
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NUP50 Antibody (NBP2-13683) (0)

There are no publications for NUP50 Antibody (NBP2-13683).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUP50 Antibody (NBP2-13683) (0)

There are no reviews for NUP50 Antibody (NBP2-13683). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NUP50 Antibody (NBP2-13683) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NUP50 Products

Bioinformatics Tool for NUP50 Antibody (NBP2-13683)

Discover related pathways, diseases and genes to NUP50 Antibody (NBP2-13683). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUP50 Antibody (NBP2-13683)

Discover more about diseases related to NUP50 Antibody (NBP2-13683).

Pathways for NUP50 Antibody (NBP2-13683)

View related products by pathway.

PTMs for NUP50 Antibody (NBP2-13683)

Learn more about PTMs related to NUP50 Antibody (NBP2-13683).

Blogs on NUP50

There are no specific blogs for NUP50, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NUP50 Antibody and receive a gift card or discount.


Gene Symbol NUP50