Nup153 Antibody - BSA Free

Western Blot: Nup153 Antibody [NBP1-81725] - Analysis in human cell line K562.

Immunocytochemistry/Immunofluorescence: Nup153 Antibody [NBP1-81725] - Staining of human cell line U-251 MG shows localization to nuclear membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Nup153 Antibody [NBP1-81725] - Staining of human testis shows strong positivity in nuclear membrane in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Nup153 Antibody [NBP1-81725] - Analysis in human testis and pancreas tissues. Corresponding NUP153 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Nup153 Antibody [NBP1-81725] - Staining of human endometrium shows strong positivity in nuclear membrane in glandular cells.

Immunohistochemistry-Paraffin: Nup153 Antibody [NBP1-81725] - Staining of human pancreas shows weak positivity in nuclear membrane in islets of Langerhans.

Immunohistochemistry-Paraffin: Nup153 Antibody [NBP1-81725] - Staining of human prostate shows moderate positivity in nuclear membrane and cytoplasm in smooth muscle cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Nup153 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Nup153 Antibody - BSA Free (NBP1-81725) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Nup153 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GQNREQRESGFSYPNFSLPAANGLSSGVGGGGGKMRRERTRFVASKPLEEEEMEVPVLPKISLPITSSSLPTFNFSSPEITTSSPSPINSSQALTNKVQMTSP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUP153
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Nup153 Protein (NBP1-81725PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Nup153 Antibody - BSA Free

• CG4453
• dmNup153
• dNup153
• HNUP153
• N153
• nuclear pore complex protein hnup153,153 kDa nucleoporin
• nuclear pore complex protein Nup153
• nucleoporin 153kD
• nucleoporin 153kDa
• Nucleoporin Nup153
• Nup 153
• Nup153 Nucleoporin 153
• nup153

Background

Nuclear pore complexes are extremely elaborate structures that mediate the regulated movement of macromolecules between the nucleus and cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. Nucleoporins are pore complex specific glycoproteins characterized by cytoplasmically oriented O linked N acetylglucosamine residues and numerous repeats of the pentapeptide sequence XFXFG. Nup153 has three distinct domains: a N terminal region within which a pore targeting domain has been identified, a central region containing multiple zinc finger motifs, and a C terminal region containing multiple XFXFG repeats. Nup153 is a possible DNA binding subunit of the nuclear pore complex (NPC). The repeat containing domain may be involved in anchoring components of the pore complex to the pore membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Nup153 Antibody (NBP1-81725)(1)

Publication using NBP1-81725

• Alonso-Puyo J, Izagirre-Fernandez O, Crende O et Al. The Non-Linear Profile of Aging: U-Shaped Expression of Myostatin, Follistatin and Intermediate Signals in a Longitudinal In Vitro Murine Cell Sarcopenia Model Proteomes 2024-11-22 [PMID: 39585121]

Bioinformatics

• Gene Symbol: NUP153