Recombinant Human Nucleostemin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Nucleostemin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 328-427 of Human GNL3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GNL3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nucleostemin Protein

  • C77032
  • E2IG3NNP47
  • estradiol-induced nucleotide binding protein
  • GNL3
  • guanine nucleotide binding protein-like 3 (nucleolar)
  • guanine nucleotide-binding protein-like 3
  • MGC800
  • Novel nucleolar protein 47
  • NSE2-induced gene 3 protein
  • Nucleolar GTP-binding protein 3
  • Nucleostemin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
H00026354-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Nucleostemin Partial Recombinant Protein (H00026354-Q01) (0)

There are no publications for Nucleostemin Partial Recombinant Protein (H00026354-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nucleostemin Partial Recombinant Protein (H00026354-Q01) (0)

There are no reviews for Nucleostemin Partial Recombinant Protein (H00026354-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nucleostemin Partial Recombinant Protein (H00026354-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nucleostemin Products

Bioinformatics Tool for Nucleostemin Partial Recombinant Protein (H00026354-Q01)

Discover related pathways, diseases and genes to Nucleostemin Partial Recombinant Protein (H00026354-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleostemin Partial Recombinant Protein (H00026354-Q01)

Discover more about diseases related to Nucleostemin Partial Recombinant Protein (H00026354-Q01).
 

Pathways for Nucleostemin Partial Recombinant Protein (H00026354-Q01)

View related products by pathway.

PTMs for Nucleostemin Partial Recombinant Protein (H00026354-Q01)

Learn more about PTMs related to Nucleostemin Partial Recombinant Protein (H00026354-Q01).
 

Research Areas for Nucleostemin Partial Recombinant Protein (H00026354-Q01)

Find related products by research area.

Blogs on Nucleostemin

There are no specific blogs for Nucleostemin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nucleostemin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GNL3
Entrez