![Western Blot: Nucleoredoxin Antibody [NBP1-82289] - Analysis in human cell lines Caco-2 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.](http://images.novusbio.com/fullsize/Nucleoredoxin-Antibody-Western-Blot-NBP1-82289-img0013.jpg "Western Blot: Nucleoredoxin Antibody [NBP1-82289] - Analysis in human cell lines Caco-2 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Nucleoredoxin Antibody - BSA Free (NBP1-82289) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEAFVNDFLAEKLKPEPI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NXN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NXN |
![Immunocytochemistry/Immunofluorescence: Nucleoredoxin Antibody [NBP1-82289] - Staining of human cell line U-2 OS shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Nucleoredoxin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82289-img0011.jpg "Immunocytochemistry/Immunofluorescence: Nucleoredoxin Antibody [NBP1-82289] - Staining of human cell line U-2 OS shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Nucleoredoxin Antibody [NBP1-82289] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.](http://images.novusbio.com/fullsize/Nucleoredoxin-Antibody-Immunohistochemistry-Paraffin-NBP1-82289-img0012.jpg "Immunohistochemistry-Paraffin: Nucleoredoxin Antibody [NBP1-82289] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.")
![Western Blot: Nucleoredoxin Antibody [NBP1-82289] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/Nucleoredoxin-Antibody-Western-Blot-NBP1-82289-img0010.jpg "Western Blot: Nucleoredoxin Antibody [NBP1-82289] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Western Blot: Nucleoredoxin Antibody [NBP1-82289] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Nucleoredoxin-Antibody-Western-Blot-NBP1-82289-img0014.jpg "Western Blot: Nucleoredoxin Antibody [NBP1-82289] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")