Nucleoredoxin Antibody

Images

 
Western Blot: Nucleoredoxin Antibody [NBP1-82289] - Analysis in human cell lines Caco-2 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Immunocytochemistry/ Immunofluorescence: Nucleoredoxin Antibody [NBP1-82289] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: Nucleoredoxin Antibody [NBP1-82289] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
Western Blot: Nucleoredoxin Antibody [NBP1-82289] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: Nucleoredoxin Antibody [NBP1-82289] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Nucleoredoxin Antibody [NBP1-82289] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nucleoredoxin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEAFVNDFLAEKLKPEPI
Specificity
Specificity of human, mouse, rat Nucleoredoxin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NXN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Nucleoredoxin Recombinant Protein Antigen (NBP1-82289PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nucleoredoxin Antibody

  • EC 1.8.1.8
  • NRN
  • NRX
  • NRXFLJ12614
  • nucleoredoxin 1
  • Nucleoredoxin
  • NXN
  • TRG-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7548
Species: Hu
Applications: IHC
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4340
Species: Hu, Rt
Applications: WB, IHC
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
AF3399
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-65123
Species: Hu
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP2-38492
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-67623
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80848
Species: Hu
Applications: IHC, IHC-P
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Nucleoredoxin Antibody (NBP1-82289) (0)

There are no publications for Nucleoredoxin Antibody (NBP1-82289).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nucleoredoxin Antibody (NBP1-82289) (0)

There are no reviews for Nucleoredoxin Antibody (NBP1-82289). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nucleoredoxin Antibody (NBP1-82289) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Nucleoredoxin Antibody (NBP1-82289)

Discover related pathways, diseases and genes to Nucleoredoxin Antibody (NBP1-82289). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleoredoxin Antibody (NBP1-82289)

Discover more about diseases related to Nucleoredoxin Antibody (NBP1-82289).
 

Pathways for Nucleoredoxin Antibody (NBP1-82289)

View related products by pathway.

PTMs for Nucleoredoxin Antibody (NBP1-82289)

Learn more about PTMs related to Nucleoredoxin Antibody (NBP1-82289).

Blogs on Nucleoredoxin

There are no specific blogs for Nucleoredoxin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nucleoredoxin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NXN
Entrez