Nucleoporin NUP85 Antibody

Images

 
Western Blot: Nucleoporin NUP85/Pericentrin 1 Antibody [NBP2-56709] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: Nucleoporin NUP85/Pericentrin 1 Antibody [NBP2-56709] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nucleoporin NUP85 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ
Specificity
Specificity of human Nucleoporin NUP85/Pericentrin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUP85
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Nucleoporin NUP85 Recombinant Protein Antigen (NBP2-56709PEP)

Reactivity Notes

Mouse 83%, Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Nucleoporin NUP85 Antibody

  • 85 kDa nucleoporin
  • FLJ12549
  • FROUNT
  • nuclear pore complex protein Nup85
  • nucleoporin 85kDa
  • Nucleoporin Nup75
  • Nucleoporin Nup85
  • Nucleoporin
  • Nup75
  • NUP85
  • PCNT
  • PCNT1
  • Pericentrin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76926
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB150
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-23718
Species: Hu, Bv, Eq, Pm
Applications: IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Ha, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP, KD, KO
H00055746-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-61832
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB90551
Species: Hu, Mu, Rt
Applications: WB
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP1-80773
Species: Hu
Applications: IHC, IHC-P
NBP1-81546
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF2905
Species: Hu
Applications: WB, ELISA, ICC
NBP1-92685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-56709
Species: Hu
Applications: WB, ICC/IF

Publications for Nucleoporin NUP85 Antibody (NBP2-56709) (0)

There are no publications for Nucleoporin NUP85 Antibody (NBP2-56709).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nucleoporin NUP85 Antibody (NBP2-56709) (0)

There are no reviews for Nucleoporin NUP85 Antibody (NBP2-56709). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nucleoporin NUP85 Antibody (NBP2-56709) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Nucleoporin NUP85 Products

Bioinformatics Tool for Nucleoporin NUP85 Antibody (NBP2-56709)

Discover related pathways, diseases and genes to Nucleoporin NUP85 Antibody (NBP2-56709). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleoporin NUP85 Antibody (NBP2-56709)

Discover more about diseases related to Nucleoporin NUP85 Antibody (NBP2-56709).
 

Pathways for Nucleoporin NUP85 Antibody (NBP2-56709)

View related products by pathway.

PTMs for Nucleoporin NUP85 Antibody (NBP2-56709)

Learn more about PTMs related to Nucleoporin NUP85 Antibody (NBP2-56709).

Blogs on Nucleoporin NUP85

There are no specific blogs for Nucleoporin NUP85, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nucleoporin NUP85 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUP85