Nucleoporin NUP85 Antibody - BSA Free

Western Blot: Nucleoporin NUP85/Pericentrin 1 Antibody [NBP2-56709] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: Nucleoporin NUP85/Pericentrin 1 Antibody [NBP2-56709] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Nucleoporin NUP85 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUP85
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Nucleoporin NUP85 Recombinant Protein Antigen (NBP2-56709PEP)

Reactivity Notes

Mouse 83%, Rat 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Nucleoporin NUP85 Antibody - BSA Free

• 85 kDa nucleoporin
• FLJ12549
• FROUNT
• nuclear pore complex protein Nup85
• nucleoporin 85kDa
• Nucleoporin Nup75
• Nucleoporin Nup85
• Nucleoporin
• Nup75
• NUP85
• PCNT
• PCNT1
• Pericentrin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUP85