Nuclear Factor Erythroid 2 Related Factor 1 Antibody

Images

 
Western Blot: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-55915] - Analysis in human cell line EFO-21.
Immunocytochemistry/ Immunofluorescence: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-55915] - Staining of human cell line RH-30 shows localization to nucleus & cytosol. Antibody staining is shown in green.

Order Details


    • Catalog Number
      NBP2-55915
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Nuclear Factor Erythroid 2 Related Factor 1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FDYSHRQKEQDVEKELRDGGEQDTWAGEGAEALARNLLVDGETGESFPAQVPSGEDQTALSL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFE2L1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publications using
NBP2-55915 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Nuclear Factor Erythroid 2 Related Factor 1 Antibody

  • FLJ00380
  • HBZ17
  • LCR-F1
  • Locus control region-factor 1
  • NF-E2-related factor 1
  • NFE2-related factor 1
  • NRF1TCF11
  • nuclear factor (erythroid-derived 2)-like 1
  • nuclear factor erythroid 2-related factor 1
  • Nuclear factor, erythroid derived 2, like 1
  • TCF-11
  • transcription factor 11 (basic leucine zipper type)
  • Transcription factor 11
  • Transcription factor HBZ17
  • Transcription factor LCR-F1

Background

Nuclear Factor Erythroid 2 Related Factor 1 is a 772 amino acid transcription factor. It interacts with KEAP1 and activates globin gene expression in erythrocytes. It may play a role in hepatits and anemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP1-71648
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB
NBP1-32105
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-82580
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00002729-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-29103
Species: Hu
Applications: IHC, IP, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P
3047-CC
Species: Hu
Applications: BA
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA

Publications for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-55915)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 3 of 3.
Publications using NBP2-55915 Applications Species
Billingsley J Effect of NFE2L1 Overexpression and Knock Down on the Response of XBP1 Splice Variants to Endoplasmic Reticulum Stress Carleton University 2021-03-24 (WB) WB
Sheng J Cellular Effects Nanosilver on Cancer and Non-cancer Cells: Potential Environmental and Human Health Impacts Thesis
Cameron S Anti-Cancer and Stress Response Pathway Effects of Nanosilver and Sodium Ascorbate Carleton University 2022-07-11 (WB, Human) WB Human

Reviews for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-55915) (0)

There are no reviews for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-55915). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-55915) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nuclear Factor Erythroid 2 Related Factor 1 Products

Research Areas for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-55915)

Find related products by research area.

Blogs on Nuclear Factor Erythroid 2 Related Factor 1

There are no specific blogs for Nuclear Factor Erythroid 2 Related Factor 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nuclear Factor Erythroid 2 Related Factor 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFE2L1