Nuclear Factor Erythroid 2 Related Factor 1 Antibody

Western Blot: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-55915] - Analysis in human cell line EFO-21.

Immunocytochemistry/Immunofluorescence: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-55915] - Staining of human cell line RH-30 shows localization to nucleus & cytosol. Antibody staining is shown in green.

Product Discontinued

Nuclear Factor Erythroid 2 Related Factor 1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FDYSHRQKEQDVEKELRDGGEQDTWAGEGAEALARNLLVDGETGESFPAQVPSGEDQTALSL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFE2L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Nuclear Factor Erythroid 2 Related Factor 1 Antibody

• FLJ00380
• HBZ17
• LCR-F1
• Locus control region-factor 1
• NF-E2-related factor 1
• NFE2-related factor 1
• NRF1TCF11
• nuclear factor (erythroid-derived 2)-like 1
• nuclear factor erythroid 2-related factor 1
• Nuclear factor, erythroid derived 2, like 1
• TCF-11
• transcription factor 11 (basic leucine zipper type)
• Transcription factor 11
• Transcription factor HBZ17
• Transcription factor LCR-F1

Background

Nuclear Factor Erythroid 2 Related Factor 1 is a 772 amino acid transcription factor. It interacts with KEAP1 and activates globin gene expression in erythrocytes. It may play a role in hepatits and anemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-55915)(3)

Publications using NBP2-55915

• Billingsley J Effect of NFE2L1 Overexpression and Knock Down on the Response of XBP1 Splice Variants to Endoplasmic Reticulum Stress Carleton University 2021-03-24 (WB)
• Sheng J Cellular Effects Nanosilver on Cancer and Non-cancer Cells: Potential Environmental and Human Health Impacts Thesis
• Cameron S Anti-Cancer and Stress Response Pathway Effects of Nanosilver and Sodium Ascorbate Carleton University 2022-07-11 (WB, Human)

Bioinformatics

• Gene Symbol: NFE2L1